Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3293144..3293763 | Replicon | chromosome |
| Accession | NZ_CP099328 | ||
| Organism | Escherichia fergusonii strain RHB44-C21 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NFL02_RS15870 | Protein ID | WP_001280991.1 |
| Coordinates | 3293545..3293763 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | NFL02_RS15865 | Protein ID | WP_104917851.1 |
| Coordinates | 3293144..3293518 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL02_RS15855 (3288276) | 3288276..3289469 | + | 1194 | WP_002431407.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFL02_RS15860 (3289492) | 3289492..3292641 | + | 3150 | WP_001132493.1 | efflux RND transporter permease AcrB | - |
| NFL02_RS15865 (3293144) | 3293144..3293518 | + | 375 | WP_104917851.1 | Hha toxicity modulator TomB | Antitoxin |
| NFL02_RS15870 (3293545) | 3293545..3293763 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NFL02_RS15875 (3294260) | 3294260..3294730 | + | 471 | WP_181591585.1 | YlaC family protein | - |
| NFL02_RS15880 (3294869) | 3294869..3296419 | + | 1551 | WP_001260376.1 | EAL domain-containing protein | - |
| NFL02_RS15885 (3296461) | 3296461..3296814 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NFL02_RS15895 (3297193) | 3297193..3297504 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NFL02_RS15900 (3297535) | 3297535..3298107 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T248474 WP_001280991.1 NZ_CP099328:3293545-3293763 [Escherichia fergusonii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14511.31 Da Isoelectric Point: 4.8989
>AT248474 WP_104917851.1 NZ_CP099328:3293144-3293518 [Escherichia fergusonii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|