Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1367189..1367814 | Replicon | chromosome |
Accession | NZ_CP099328 | ||
Organism | Escherichia fergusonii strain RHB44-C21 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | NFL02_RS06505 | Protein ID | WP_000911329.1 |
Coordinates | 1367416..1367814 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NFL02_RS06500 | Protein ID | WP_000450524.1 |
Coordinates | 1367189..1367416 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL02_RS06475 (1362991) | 1362991..1363461 | - | 471 | WP_001068688.1 | thioredoxin-dependent thiol peroxidase | - |
NFL02_RS06480 (1363461) | 1363461..1364033 | - | 573 | WP_000189057.1 | glycine cleavage system transcriptional repressor | - |
NFL02_RS06485 (1364180) | 1364180..1365058 | + | 879 | WP_000494011.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NFL02_RS06490 (1365075) | 1365075..1366109 | + | 1035 | WP_046077201.1 | outer membrane protein assembly factor BamC | - |
NFL02_RS06495 (1366321) | 1366321..1367034 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NFL02_RS06500 (1367189) | 1367189..1367416 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NFL02_RS06505 (1367416) | 1367416..1367814 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFL02_RS06510 (1367961) | 1367961..1368824 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
NFL02_RS06515 (1368839) | 1368839..1370854 | + | 2016 | WP_279284300.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NFL02_RS06520 (1370928) | 1370928..1371626 | + | 699 | WP_000679802.1 | esterase | - |
NFL02_RS06525 (1371719) | 1371719..1371919 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T248469 WP_000911329.1 NZ_CP099328:1367416-1367814 [Escherichia fergusonii]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |