Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 747676..748226 Replicon chromosome
Accession NZ_CP099328
Organism Escherichia fergusonii strain RHB44-C21

Toxin (Protein)


Gene name ccdB Uniprot ID F0JPU1
Locus tag NFL02_RS03715 Protein ID WP_001160963.1
Coordinates 747912..748226 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag NFL02_RS03710 Protein ID WP_000125566.1
Coordinates 747676..747909 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFL02_RS03685 (742748) 742748..743035 + 288 WP_279284221.1 ferredoxin-like protein FixX -
NFL02_RS03690 (743094) 743094..744425 + 1332 WP_104919955.1 MFS transporter -
NFL02_RS03695 (744533) 744533..745063 + 531 WP_000600701.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NFL02_RS03700 (745056) 745056..746918 + 1863 WP_181667121.1 glutathione-regulated potassium-efflux system protein KefC -
NFL02_RS03705 (747111) 747111..747590 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
NFL02_RS03710 (747676) 747676..747909 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NFL02_RS03715 (747912) 747912..748226 + 315 WP_001160963.1 CcdB family protein Toxin
NFL02_RS03720 (748223) 748223..749071 - 849 WP_000257179.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NFL02_RS03725 (749078) 749078..749455 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NFL02_RS03730 (749458) 749458..750279 - 822 WP_279284222.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NFL02_RS03735 (750276) 750276..751265 - 990 WP_046076786.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NFL02_RS03740 (751265) 751265..752551 - 1287 WP_181667122.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11722.70 Da        Isoelectric Point: 8.0666

>T248466 WP_001160963.1 NZ_CP099328:747912-748226 [Escherichia fergusonii]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSHIRPPERLNPILLLVDGKEYVLMTHETATVPVNTLG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT248466 WP_000125566.1 NZ_CP099328:747676-747909 [Escherichia fergusonii]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB F0JPU1

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References