Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3931812..3932469 | Replicon | chromosome |
Accession | NZ_CP099327 | ||
Organism | Enterobacter ludwigii strain RHB47-SO-C03 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | G8LDB6 |
Locus tag | NFL62_RS18830 | Protein ID | WP_014171514.1 |
Coordinates | 3931812..3932222 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | NFL62_RS18835 | Protein ID | WP_003863437.1 |
Coordinates | 3932203..3932469 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL62_RS18810 (NFL62_18805) | 3927810..3929543 | - | 1734 | WP_044866092.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFL62_RS18815 (NFL62_18810) | 3929549..3930262 | - | 714 | WP_020883731.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFL62_RS18820 (NFL62_18815) | 3930286..3931182 | - | 897 | WP_279257832.1 | site-specific tyrosine recombinase XerD | - |
NFL62_RS18825 (NFL62_18820) | 3931284..3931805 | + | 522 | WP_014171513.1 | flavodoxin FldB | - |
NFL62_RS18830 (NFL62_18825) | 3931812..3932222 | - | 411 | WP_014171514.1 | protein YgfX | Toxin |
NFL62_RS18835 (NFL62_18830) | 3932203..3932469 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
NFL62_RS18840 (NFL62_18835) | 3932764..3933744 | + | 981 | WP_020883730.1 | tRNA-modifying protein YgfZ | - |
NFL62_RS18845 (NFL62_18840) | 3933855..3934514 | - | 660 | WP_014171517.1 | hemolysin III family protein | - |
NFL62_RS18850 (NFL62_18845) | 3934781..3935512 | + | 732 | WP_020883729.1 | MurR/RpiR family transcriptional regulator | - |
NFL62_RS18855 (NFL62_18850) | 3935629..3937062 | + | 1434 | WP_020883728.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16217.15 Da Isoelectric Point: 11.5020
>T248464 WP_014171514.1 NZ_CP099327:c3932222-3931812 [Enterobacter ludwigii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A839BUV6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |