Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3886903..3887560 | Replicon | chromosome |
Accession | NZ_CP099325 | ||
Organism | Enterobacter ludwigii strain RHB47-SO-C01 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | G8LDB6 |
Locus tag | NFL61_RS18390 | Protein ID | WP_014171514.1 |
Coordinates | 3886903..3887313 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | NFL61_RS18395 | Protein ID | WP_003863437.1 |
Coordinates | 3887294..3887560 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL61_RS18370 (NFL61_18365) | 3882901..3884634 | - | 1734 | WP_279258609.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFL61_RS18375 (NFL61_18370) | 3884640..3885353 | - | 714 | WP_020883731.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFL61_RS18380 (NFL61_18375) | 3885377..3886273 | - | 897 | WP_014171511.1 | site-specific tyrosine recombinase XerD | - |
NFL61_RS18385 (NFL61_18380) | 3886375..3886896 | + | 522 | WP_183516698.1 | flavodoxin FldB | - |
NFL61_RS18390 (NFL61_18385) | 3886903..3887313 | - | 411 | WP_014171514.1 | protein YgfX | Toxin |
NFL61_RS18395 (NFL61_18390) | 3887294..3887560 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
NFL61_RS18400 (NFL61_18395) | 3887855..3888835 | + | 981 | WP_020883730.1 | tRNA-modifying protein YgfZ | - |
NFL61_RS18405 (NFL61_18400) | 3888946..3889605 | - | 660 | WP_014171517.1 | hemolysin III family protein | - |
NFL61_RS18410 (NFL61_18405) | 3889872..3890603 | + | 732 | WP_086532136.1 | MurR/RpiR family transcriptional regulator | - |
NFL61_RS18415 (NFL61_18410) | 3890720..3892153 | + | 1434 | WP_032678925.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16217.15 Da Isoelectric Point: 11.5020
>T248456 WP_014171514.1 NZ_CP099325:c3887313-3886903 [Enterobacter ludwigii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A839BUV6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |