Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 3628714..3629432 Replicon chromosome
Accession NZ_CP099325
Organism Enterobacter ludwigii strain RHB47-SO-C01

Toxin (Protein)


Gene name ypjF Uniprot ID -
Locus tag NFL61_RS17180 Protein ID WP_104868302.1
Coordinates 3629103..3629432 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag NFL61_RS17175 Protein ID WP_279258550.1
Coordinates 3628714..3629055 (+) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFL61_RS17135 (NFL61_17130) 3624128..3625015 + 888 WP_279258548.1 50S ribosome-binding GTPase -
NFL61_RS17140 (NFL61_17135) 3625227..3625481 + 255 WP_181397041.1 hypothetical protein -
NFL61_RS17145 (NFL61_17140) 3625510..3625974 + 465 WP_134879110.1 hypothetical protein -
NFL61_RS17150 (NFL61_17145) 3625995..3626336 + 342 WP_104868308.1 hypothetical protein -
NFL61_RS17155 (NFL61_17150) 3626416..3627237 + 822 WP_279259328.1 DUF932 domain-containing protein -
NFL61_RS17160 (NFL61_17155) 3627570..3627965 + 396 WP_181397040.1 antirestriction protein -
NFL61_RS17165 (NFL61_17160) 3627977..3628486 + 510 WP_279258549.1 DNA repair protein RadC -
NFL61_RS17170 (NFL61_17165) 3628470..3628691 + 222 WP_104868304.1 DUF987 domain-containing protein -
NFL61_RS17175 (NFL61_17170) 3628714..3629055 + 342 WP_279258550.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFL61_RS17180 (NFL61_17175) 3629103..3629432 + 330 WP_104868302.1 TA system toxin CbtA family protein Toxin
NFL61_RS17185 (NFL61_17180) 3629998..3630165 + 168 WP_237770636.1 hypothetical protein -
NFL61_RS17190 (NFL61_17185) 3630715..3631155 + 441 WP_279258551.1 carboxypeptidase regulatory-like domain-containing protein -
NFL61_RS17195 (NFL61_17190) 3631376..3631732 + 357 WP_014171277.1 hypothetical protein -
NFL61_RS17200 (NFL61_17195) 3631820..3632164 + 345 WP_020883895.1 hypothetical protein -
NFL61_RS17205 (NFL61_17200) 3632233..3632790 + 558 WP_279258552.1 YceI family protein -
NFL61_RS17210 (NFL61_17205) 3632782..3633570 - 789 WP_149377108.1 hypothetical protein -
NFL61_RS17215 (NFL61_17210) 3633567..3634097 - 531 WP_080346980.1 sigma-70 family RNA polymerase sigma factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3599864..3631155 31291


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-108)

Antitoxin

Antitoxin CbeA

(12-112)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12407.16 Da        Isoelectric Point: 8.9981

>T248455 WP_104868302.1 NZ_CP099325:3629103-3629432 [Enterobacter ludwigii]
MQTLSSHPIRATQPCLSPVETWQRLLTHLLSQHYGLTLNDTPFSNETTIREHIDAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYLSVVDILRARRSTGLLKTNVK

Download         Length: 330 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12675.50 Da        Isoelectric Point: 6.5943

>AT248455 WP_279258550.1 NZ_CP099325:3628714-3629055 [Enterobacter ludwigii]
MKNIKNHDIAGPWWGLKPTVMPCFGVRLVQEGNRLHYLADQASITGSFSDADLRHLDQAFPVLLKQLELMLVSGELTSHH
QHRVTLYHNGLTCEADTLGSCGYVYIAIYPDQP

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References