Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3488751..3489372 | Replicon | chromosome |
Accession | NZ_CP099323 | ||
Organism | Enterobacter hormaechei strain RHB45-SO-C08 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A837FFM2 |
Locus tag | NFL40_RS16590 | Protein ID | WP_015571250.1 |
Coordinates | 3489154..3489372 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | F5RUW7 |
Locus tag | NFL40_RS16585 | Protein ID | WP_006809850.1 |
Coordinates | 3488751..3489125 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL40_RS16575 (NFL40_16565) | 3483879..3485072 | + | 1194 | WP_022647272.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFL40_RS16580 (NFL40_16570) | 3485095..3488241 | + | 3147 | WP_023299464.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NFL40_RS16585 (NFL40_16575) | 3488751..3489125 | + | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
NFL40_RS16590 (NFL40_16580) | 3489154..3489372 | + | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
NFL40_RS16595 (NFL40_16585) | 3489580..3490131 | + | 552 | WP_048966011.1 | maltose O-acetyltransferase | - |
NFL40_RS16600 (NFL40_16590) | 3490248..3490715 | + | 468 | WP_048966010.1 | YlaC family protein | - |
NFL40_RS16605 (NFL40_16595) | 3490687..3492147 | - | 1461 | WP_023299463.1 | PLP-dependent aminotransferase family protein | - |
NFL40_RS16610 (NFL40_16600) | 3492250..3492960 | + | 711 | WP_048966166.1 | GNAT family protein | - |
NFL40_RS16615 (NFL40_16605) | 3492957..3493097 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
NFL40_RS16620 (NFL40_16610) | 3493100..3493360 | - | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T248448 WP_015571250.1 NZ_CP099323:3489154-3489372 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT248448 WP_006809850.1 NZ_CP099323:3488751-3489125 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FFM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FGN8 |