Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/FR47-DUF1778 |
| Location | 39494..40291 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP099319 | ||
| Organism | Enterobacter hormaechei strain RHB45-SO-C02 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | F5S3R9 |
| Locus tag | NFL35_RS22910 | Protein ID | WP_006812498.1 |
| Coordinates | 39767..40291 (+) | Length | 175 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | F5S3R8 |
| Locus tag | NFL35_RS22905 | Protein ID | WP_006812497.1 |
| Coordinates | 39494..39763 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL35_RS22880 (NFL35_22865) | 34867..36207 | - | 1341 | WP_006812582.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| NFL35_RS22885 (NFL35_22870) | 36268..36993 | - | 726 | WP_006812583.1 | hypothetical protein | - |
| NFL35_RS22890 (NFL35_22875) | 37257..38054 | + | 798 | WP_006812584.1 | DUF2971 domain-containing protein | - |
| NFL35_RS22895 (NFL35_22880) | 38096..38449 | - | 354 | WP_160859104.1 | hypothetical protein | - |
| NFL35_RS22900 (NFL35_22885) | 38455..39120 | - | 666 | WP_023315962.1 | AAA family ATPase | - |
| NFL35_RS22905 (NFL35_22890) | 39494..39763 | + | 270 | WP_006812497.1 | DUF1778 domain-containing protein | Antitoxin |
| NFL35_RS22910 (NFL35_22895) | 39767..40291 | + | 525 | WP_006812498.1 | GNAT family N-acetyltransferase | Toxin |
| NFL35_RS22915 (NFL35_22900) | 40318..40482 | - | 165 | WP_006812499.1 | hypothetical protein | - |
| NFL35_RS22920 (NFL35_22905) | 40475..40726 | - | 252 | WP_000147960.1 | hypothetical protein | - |
| NFL35_RS22925 (NFL35_22910) | 40728..41420 | - | 693 | WP_006812500.1 | membrane protein | - |
| NFL35_RS22930 (NFL35_22915) | 41434..41757 | - | 324 | WP_000064173.1 | hypothetical protein | - |
| NFL35_RS22935 (NFL35_22920) | 41832..42620 | - | 789 | WP_032655902.1 | receptor-recognizing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..111406 | 111406 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19356.13 Da Isoelectric Point: 8.9844
>T248438 WP_006812498.1 NZ_CP099319:39767-40291 [Enterobacter hormaechei]
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0QWY8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0QUA3 |