Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2310388..2311127 | Replicon | chromosome |
Accession | NZ_CP099316 | ||
Organism | Enterobacter hormaechei strain RHB44-SE-C02 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A801DRD7 |
Locus tag | NFL06_RS11110 | Protein ID | WP_017693417.1 |
Coordinates | 2310388..2310873 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | NFL06_RS11115 | Protein ID | WP_003857131.1 |
Coordinates | 2310861..2311127 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL06_RS11090 (NFL06_11080) | 2306541..2307299 | - | 759 | WP_279262821.1 | trans-aconitate 2-methyltransferase | - |
NFL06_RS11095 (NFL06_11085) | 2307384..2307968 | - | 585 | WP_045329825.1 | NUDIX domain-containing protein | - |
NFL06_RS11100 (NFL06_11090) | 2308055..2308813 | + | 759 | WP_015570520.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NFL06_RS11105 (NFL06_11095) | 2308918..2310210 | + | 1293 | WP_048229549.1 | glycosyl hydrolase family 28 protein | - |
NFL06_RS11110 (NFL06_11100) | 2310388..2310873 | - | 486 | WP_017693417.1 | GNAT family N-acetyltransferase | Toxin |
NFL06_RS11115 (NFL06_11105) | 2310861..2311127 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
NFL06_RS11120 (NFL06_11110) | 2311191..2312120 | - | 930 | WP_017693416.1 | LysR family transcriptional regulator | - |
NFL06_RS11125 (NFL06_11115) | 2312250..2313632 | + | 1383 | WP_045345182.1 | MFS transporter | - |
NFL06_RS11130 (NFL06_11120) | 2313654..2314649 | - | 996 | WP_047735388.1 | DUF2891 domain-containing protein | - |
NFL06_RS11135 (NFL06_11125) | 2314659..2315645 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17570.26 Da Isoelectric Point: 9.9658
>T248419 WP_017693417.1 NZ_CP099316:c2310873-2310388 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKTFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKTFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|