Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | KacT-ataR/DUF1778(antitoxin) |
Location | 1695929..1696726 | Replicon | chromosome |
Accession | NZ_CP099316 | ||
Organism | Enterobacter hormaechei strain RHB44-SE-C02 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A4Q2R3N2 |
Locus tag | NFL06_RS07970 | Protein ID | WP_032670168.1 |
Coordinates | 1696205..1696726 (+) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A331QJY7 |
Locus tag | NFL06_RS07965 | Protein ID | WP_015570876.1 |
Coordinates | 1695929..1696198 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL06_RS07930 (NFL06_07925) | 1691469..1691828 | + | 360 | WP_017384779.1 | helix-turn-helix domain-containing protein | - |
NFL06_RS07935 (NFL06_07930) | 1691907..1692002 | - | 96 | Protein_1537 | transcriptional regulator | - |
NFL06_RS07940 (NFL06_07935) | 1692155..1693396 | + | 1242 | WP_039271154.1 | bifunctional glucose-1-phosphatase/inositol phosphatase | - |
NFL06_RS07945 (NFL06_07940) | 1693429..1693656 | - | 228 | WP_006809324.1 | YccJ family protein | - |
NFL06_RS07950 (NFL06_07945) | 1693675..1694271 | - | 597 | WP_006809323.1 | NAD(P)H:quinone oxidoreductase | - |
NFL06_RS07955 (NFL06_07950) | 1694663..1694833 | + | 171 | WP_001273664.1 | general stress protein | - |
NFL06_RS07960 (NFL06_07955) | 1694950..1695855 | + | 906 | WP_017693666.1 | DMT family transporter | - |
NFL06_RS07965 (NFL06_07960) | 1695929..1696198 | + | 270 | WP_015570876.1 | DUF1778 domain-containing protein | Antitoxin |
NFL06_RS07970 (NFL06_07965) | 1696205..1696726 | + | 522 | WP_032670168.1 | GNAT family N-acetyltransferase | Toxin |
NFL06_RS07975 (NFL06_07970) | 1696785..1698107 | - | 1323 | WP_045344078.1 | pyrimidine utilization transport protein G | - |
NFL06_RS07980 (NFL06_07975) | 1698129..1698620 | - | 492 | WP_015570873.1 | pyrimidine utilization flavin reductase protein F | - |
NFL06_RS07985 (NFL06_07980) | 1698633..1699223 | - | 591 | WP_045344080.1 | malonic semialdehyde reductase | - |
NFL06_RS07990 (NFL06_07985) | 1699233..1700033 | - | 801 | WP_048229399.1 | pyrimidine utilization protein D | - |
NFL06_RS07995 (NFL06_07990) | 1700041..1700427 | - | 387 | WP_015570870.1 | pyrimidine utilization protein C | - |
NFL06_RS08000 (NFL06_07995) | 1700439..1701128 | - | 690 | WP_045344084.1 | pyrimidine utilization protein B | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19437.18 Da Isoelectric Point: 7.4318
>T248418 WP_032670168.1 NZ_CP099316:1696205-1696726 [Enterobacter hormaechei]
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTEHLVRQHGGRILRGYLLKERDHPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTEHLVRQHGGRILRGYLLKERDHPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Q2R3N2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331QJY7 |