Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1114305..1114925 | Replicon | chromosome |
Accession | NZ_CP099316 | ||
Organism | Enterobacter hormaechei strain RHB44-SE-C02 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A837FFM2 |
Locus tag | NFL06_RS05295 | Protein ID | WP_015571250.1 |
Coordinates | 1114305..1114523 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | F5RUW7 |
Locus tag | NFL06_RS05300 | Protein ID | WP_006809850.1 |
Coordinates | 1114551..1114925 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL06_RS05265 (NFL06_05265) | 1110317..1110577 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
NFL06_RS05270 (NFL06_05270) | 1110580..1110720 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
NFL06_RS05275 (NFL06_05275) | 1110717..1111427 | - | 711 | WP_279262676.1 | GNAT family protein | - |
NFL06_RS05280 (NFL06_05280) | 1111529..1112989 | + | 1461 | WP_045349927.1 | PLP-dependent aminotransferase family protein | - |
NFL06_RS05285 (NFL06_05285) | 1112961..1113428 | - | 468 | WP_023296041.1 | YlaC family protein | - |
NFL06_RS05290 (NFL06_05290) | 1113545..1114096 | - | 552 | WP_015571251.1 | maltose O-acetyltransferase | - |
NFL06_RS05295 (NFL06_05295) | 1114305..1114523 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
NFL06_RS05300 (NFL06_05300) | 1114551..1114925 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
NFL06_RS05305 (NFL06_05305) | 1115436..1118582 | - | 3147 | WP_015571248.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NFL06_RS05310 (NFL06_05310) | 1118605..1119798 | - | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T248417 WP_015571250.1 NZ_CP099316:c1114523-1114305 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT248417 WP_006809850.1 NZ_CP099316:c1114925-1114551 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FFM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FGN8 |