Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 617987..618563 | Replicon | chromosome |
| Accession | NZ_CP099316 | ||
| Organism | Enterobacter hormaechei strain RHB44-SE-C02 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A800YKM1 |
| Locus tag | NFL06_RS02960 | Protein ID | WP_015572580.1 |
| Coordinates | 617987..618274 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A801DSF4 |
| Locus tag | NFL06_RS02965 | Protein ID | WP_017694570.1 |
| Coordinates | 618261..618563 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL06_RS02935 (NFL06_02935) | 613075..613794 | + | 720 | WP_017694573.1 | winged helix-turn-helix domain-containing protein | - |
| NFL06_RS02940 (NFL06_02940) | 613944..614414 | + | 471 | WP_015572576.1 | MarR family transcriptional regulator | - |
| NFL06_RS02945 (NFL06_02945) | 614411..615478 | + | 1068 | WP_026094404.1 | HlyD family secretion protein | - |
| NFL06_RS02950 (NFL06_02950) | 615468..616544 | + | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
| NFL06_RS02955 (NFL06_02955) | 616541..617812 | - | 1272 | WP_017694571.1 | DUF445 domain-containing protein | - |
| NFL06_RS02960 (NFL06_02960) | 617987..618274 | + | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
| NFL06_RS02965 (NFL06_02965) | 618261..618563 | + | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
| NFL06_RS02970 (NFL06_02970) | 618592..619230 | - | 639 | WP_017694569.1 | LysE family translocator | - |
| NFL06_RS02975 (NFL06_02975) | 619269..620021 | - | 753 | WP_015572582.1 | AraC family transcriptional regulator | - |
| NFL06_RS02980 (NFL06_02980) | 620175..621545 | + | 1371 | WP_017694568.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| NFL06_RS02985 (NFL06_02985) | 621727..622272 | - | 546 | WP_006810254.1 | YfaZ family outer membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T248415 WP_015572580.1 NZ_CP099316:617987-618274 [Enterobacter hormaechei]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|