Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 4622540..4623156 | Replicon | chromosome |
Accession | NZ_CP099314 | ||
Organism | Enterobacter hormaechei strain RHB44-SE-C01 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NFL05_RS22270 | Protein ID | WP_015569913.1 |
Coordinates | 4622540..4622911 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
Locus tag | NFL05_RS22275 | Protein ID | WP_015569912.1 |
Coordinates | 4622914..4623156 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL05_RS22255 (NFL05_22240) | 4620040..4620942 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
NFL05_RS22260 (NFL05_22245) | 4620939..4621574 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFL05_RS22265 (NFL05_22250) | 4621571..4622500 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
NFL05_RS22270 (NFL05_22255) | 4622540..4622911 | - | 372 | WP_015569913.1 | PIN domain-containing protein | Toxin |
NFL05_RS22275 (NFL05_22260) | 4622914..4623156 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
NFL05_RS22280 (NFL05_22265) | 4623355..4624275 | + | 921 | WP_015569911.1 | alpha/beta hydrolase | - |
NFL05_RS22285 (NFL05_22270) | 4624284..4625225 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
NFL05_RS22290 (NFL05_22275) | 4625270..4625707 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
NFL05_RS22295 (NFL05_22280) | 4625704..4626585 | - | 882 | WP_279262567.1 | virulence factor BrkB family protein | - |
NFL05_RS22300 (NFL05_22285) | 4626579..4627178 | - | 600 | WP_017694048.1 | glucose-1-phosphatase | - |
NFL05_RS22305 (NFL05_22290) | 4627297..4628097 | - | 801 | WP_045344666.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13767.90 Da Isoelectric Point: 6.4882
>T248414 WP_015569913.1 NZ_CP099314:c4622911-4622540 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|