Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3820428..3821085 | Replicon | chromosome |
Accession | NZ_CP099314 | ||
Organism | Enterobacter hormaechei strain RHB44-SE-C01 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A179PSF7 |
Locus tag | NFL05_RS18415 | Protein ID | WP_017382887.1 |
Coordinates | 3820428..3820838 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | NFL05_RS18420 | Protein ID | WP_003863437.1 |
Coordinates | 3820819..3821085 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL05_RS18395 (NFL05_18380) | 3816426..3818159 | - | 1734 | WP_017382886.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFL05_RS18400 (NFL05_18385) | 3818165..3818878 | - | 714 | WP_003863443.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFL05_RS18405 (NFL05_18390) | 3818907..3819803 | - | 897 | WP_017692715.1 | site-specific tyrosine recombinase XerD | - |
NFL05_RS18410 (NFL05_18395) | 3819905..3820426 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
NFL05_RS18415 (NFL05_18400) | 3820428..3820838 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
NFL05_RS18420 (NFL05_18405) | 3820819..3821085 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
NFL05_RS18425 (NFL05_18410) | 3821380..3822360 | + | 981 | WP_017692714.1 | tRNA-modifying protein YgfZ | - |
NFL05_RS18430 (NFL05_18415) | 3822472..3823131 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
NFL05_RS18435 (NFL05_18420) | 3823398..3824129 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
NFL05_RS18440 (NFL05_18425) | 3824246..3825679 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T248413 WP_017382887.1 NZ_CP099314:c3820838-3820428 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A179PSF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |