Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2310386..2311125 | Replicon | chromosome |
Accession | NZ_CP099314 | ||
Organism | Enterobacter hormaechei strain RHB44-SE-C01 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A801DRD7 |
Locus tag | NFL05_RS11105 | Protein ID | WP_017693417.1 |
Coordinates | 2310386..2310871 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | NFL05_RS11110 | Protein ID | WP_003857131.1 |
Coordinates | 2310859..2311125 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL05_RS11085 (NFL05_11075) | 2306539..2307297 | - | 759 | WP_279262821.1 | trans-aconitate 2-methyltransferase | - |
NFL05_RS11090 (NFL05_11080) | 2307382..2307966 | - | 585 | WP_045329825.1 | NUDIX domain-containing protein | - |
NFL05_RS11095 (NFL05_11085) | 2308053..2308811 | + | 759 | WP_015570520.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NFL05_RS11100 (NFL05_11090) | 2308916..2310208 | + | 1293 | WP_048229549.1 | glycosyl hydrolase family 28 protein | - |
NFL05_RS11105 (NFL05_11095) | 2310386..2310871 | - | 486 | WP_017693417.1 | GNAT family N-acetyltransferase | Toxin |
NFL05_RS11110 (NFL05_11100) | 2310859..2311125 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
NFL05_RS11115 (NFL05_11105) | 2311189..2312118 | - | 930 | WP_017693416.1 | LysR family transcriptional regulator | - |
NFL05_RS11120 (NFL05_11110) | 2312248..2313630 | + | 1383 | WP_045345182.1 | MFS transporter | - |
NFL05_RS11125 (NFL05_11115) | 2313652..2314647 | - | 996 | WP_047735388.1 | DUF2891 domain-containing protein | - |
NFL05_RS11130 (NFL05_11120) | 2314657..2315643 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17570.26 Da Isoelectric Point: 9.9658
>T248406 WP_017693417.1 NZ_CP099314:c2310871-2310386 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKTFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKTFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|