Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 617988..618564 | Replicon | chromosome |
Accession | NZ_CP099314 | ||
Organism | Enterobacter hormaechei strain RHB44-SE-C01 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A800YKM1 |
Locus tag | NFL05_RS02955 | Protein ID | WP_015572580.1 |
Coordinates | 617988..618275 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A801DSF4 |
Locus tag | NFL05_RS02960 | Protein ID | WP_017694570.1 |
Coordinates | 618262..618564 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL05_RS02930 (NFL05_02930) | 613076..613795 | + | 720 | WP_017694573.1 | winged helix-turn-helix domain-containing protein | - |
NFL05_RS02935 (NFL05_02935) | 613945..614415 | + | 471 | WP_015572576.1 | MarR family transcriptional regulator | - |
NFL05_RS02940 (NFL05_02940) | 614412..615479 | + | 1068 | WP_026094404.1 | HlyD family secretion protein | - |
NFL05_RS02945 (NFL05_02945) | 615469..616545 | + | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
NFL05_RS02950 (NFL05_02950) | 616542..617813 | - | 1272 | WP_017694571.1 | DUF445 domain-containing protein | - |
NFL05_RS02955 (NFL05_02955) | 617988..618275 | + | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
NFL05_RS02960 (NFL05_02960) | 618262..618564 | + | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
NFL05_RS02965 (NFL05_02965) | 618593..619231 | - | 639 | WP_017694569.1 | LysE family translocator | - |
NFL05_RS02970 (NFL05_02970) | 619270..620022 | - | 753 | WP_015572582.1 | AraC family transcriptional regulator | - |
NFL05_RS02975 (NFL05_02975) | 620176..621546 | + | 1371 | WP_017694568.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
NFL05_RS02980 (NFL05_02980) | 621728..622273 | - | 546 | WP_006810254.1 | YfaZ family outer membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T248402 WP_015572580.1 NZ_CP099314:617988-618275 [Enterobacter hormaechei]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|