Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4258589..4259350 | Replicon | chromosome |
| Accession | NZ_CP099311 | ||
| Organism | Enterobacter ludwigii strain RHB43-SE-C05 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NFK84_RS20615 | Protein ID | WP_279261683.1 |
| Coordinates | 4258973..4259350 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NFK84_RS20610 | Protein ID | WP_279261682.1 |
| Coordinates | 4258589..4258948 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK84_RS20565 (NFK84_20550) | 4253594..4254301 | + | 708 | WP_279261673.1 | transcriptional regulator | - |
| NFK84_RS20570 (NFK84_20555) | 4254298..4254864 | + | 567 | WP_279261674.1 | hypothetical protein | - |
| NFK84_RS20575 (NFK84_20560) | 4254904..4255356 | + | 453 | WP_279261675.1 | hypothetical protein | - |
| NFK84_RS20580 (NFK84_20565) | 4255353..4255793 | + | 441 | WP_279261676.1 | IrmA family protein | - |
| NFK84_RS20585 (NFK84_20570) | 4255923..4256741 | + | 819 | WP_279261677.1 | DUF932 domain-containing protein | - |
| NFK84_RS20590 (NFK84_20575) | 4256820..4257299 | + | 480 | WP_279261678.1 | antirestriction protein | - |
| NFK84_RS20595 (NFK84_20580) | 4257412..4257855 | + | 444 | WP_279261679.1 | antirestriction protein | - |
| NFK84_RS20600 (NFK84_20585) | 4257852..4258331 | + | 480 | WP_279261680.1 | DNA repair protein RadC | - |
| NFK84_RS20605 (NFK84_20590) | 4258345..4258566 | + | 222 | WP_279261681.1 | DUF987 domain-containing protein | - |
| NFK84_RS20610 (NFK84_20595) | 4258589..4258948 | + | 360 | WP_279261682.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFK84_RS20615 (NFK84_20600) | 4258973..4259350 | + | 378 | WP_279261683.1 | TA system toxin CbtA family protein | Toxin |
| NFK84_RS20620 (NFK84_20605) | 4259347..4259838 | + | 492 | WP_279261684.1 | DUF5983 family protein | - |
| NFK84_RS20625 (NFK84_20610) | 4259862..4260065 | + | 204 | WP_279261685.1 | hypothetical protein | - |
| NFK84_RS20630 (NFK84_20615) | 4260146..4260991 | + | 846 | WP_279261686.1 | DUF4942 domain-containing protein | - |
| NFK84_RS20635 (NFK84_20620) | 4261003..4261278 | + | 276 | WP_279261687.1 | hypothetical protein | - |
| NFK84_RS20640 (NFK84_20625) | 4261286..4261813 | - | 528 | WP_044857798.1 | LuxR C-terminal-related transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13886.66 Da Isoelectric Point: 8.0719
>T248401 WP_279261683.1 NZ_CP099311:4258973-4259350 [Enterobacter ludwigii]
MKTQSASATRAAPSRPSPVEIWQQLLSHLLDQHYGLTLNDTPFGNDSVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
SAETQSPLIGSIDILRARKATGLMTRHSYRAVTDITTGKYRGVQQ
MKTQSASATRAAPSRPSPVEIWQQLLSHLLDQHYGLTLNDTPFGNDSVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
SAETQSPLIGSIDILRARKATGLMTRHSYRAVTDITTGKYRGVQQ
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13260.08 Da Isoelectric Point: 6.6244
>AT248401 WP_279261682.1 NZ_CP099311:4258589-4258948 [Enterobacter ludwigii]
MSNKTRPDSHDIADPWWGLKRNITPCFGARLVQEGNRLHYLNDRASITGTFTDADLCHLDQAFPLLLKQLELMLTSGELN
PRHQHCVTLYAKGLTCEADSLGSNGYIYLVIYPTPATAA
MSNKTRPDSHDIADPWWGLKRNITPCFGARLVQEGNRLHYLNDRASITGTFTDADLCHLDQAFPLLLKQLELMLTSGELN
PRHQHCVTLYAKGLTCEADSLGSNGYIYLVIYPTPATAA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|