Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4195883..4196671 | Replicon | chromosome |
| Accession | NZ_CP099311 | ||
| Organism | Enterobacter ludwigii strain RHB43-SE-C05 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NFK84_RS20285 | Protein ID | WP_048796335.1 |
| Coordinates | 4196294..4196671 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NFK84_RS20280 | Protein ID | WP_249339873.1 |
| Coordinates | 4195883..4196242 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK84_RS20225 (NFK84_20210) | 4191151..4191450 | + | 300 | WP_213822536.1 | hypothetical protein | - |
| NFK84_RS20230 (NFK84_20215) | 4191463..4191774 | + | 312 | WP_279261633.1 | hypothetical protein | - |
| NFK84_RS20235 (NFK84_20220) | 4191821..4192291 | + | 471 | WP_038255738.1 | hypothetical protein | - |
| NFK84_RS20240 (NFK84_20225) | 4192350..4192862 | + | 513 | WP_279261634.1 | DUF4234 domain-containing protein | - |
| NFK84_RS20245 (NFK84_20230) | 4192945..4193169 | + | 225 | WP_038255742.1 | hypothetical protein | - |
| NFK84_RS20250 (NFK84_20235) | 4193227..4193460 | + | 234 | WP_025203175.1 | DUF905 domain-containing protein | - |
| NFK84_RS20255 (NFK84_20240) | 4193552..4194370 | + | 819 | WP_038255744.1 | DUF932 domain-containing protein | - |
| NFK84_RS20260 (NFK84_20245) | 4194370..4194624 | + | 255 | WP_072009073.1 | hypothetical protein | - |
| NFK84_RS20265 (NFK84_20250) | 4194641..4195126 | + | 486 | WP_279261635.1 | antirestriction protein | - |
| NFK84_RS20270 (NFK84_20255) | 4195138..4195617 | + | 480 | WP_279261636.1 | DNA repair protein RadC | - |
| NFK84_RS20275 (NFK84_20260) | 4195638..4195859 | + | 222 | WP_212563151.1 | DUF987 domain-containing protein | - |
| NFK84_RS20280 (NFK84_20265) | 4195883..4196242 | + | 360 | WP_249339873.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFK84_RS20285 (NFK84_20270) | 4196294..4196671 | + | 378 | WP_048796335.1 | TA system toxin CbtA family protein | Toxin |
| NFK84_RS20290 (NFK84_20275) | 4196668..4197159 | + | 492 | WP_048796334.1 | DUF5983 family protein | - |
| NFK84_RS20295 (NFK84_20280) | 4197189..4197392 | + | 204 | WP_048796333.1 | DUF957 domain-containing protein | - |
| NFK84_RS20300 (NFK84_20285) | 4197475..4198320 | + | 846 | WP_212563156.1 | DUF4942 domain-containing protein | - |
| NFK84_RS20305 (NFK84_20290) | 4198758..4200023 | + | 1266 | WP_279261639.1 | integrase arm-type DNA-binding domain-containing protein | - |
| NFK84_RS20310 (NFK84_20295) | 4200281..4200640 | + | 360 | Protein_3972 | IS5 family transposase | - |
| NFK84_RS20315 (NFK84_20300) | 4200684..4201163 | - | 480 | Protein_3973 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14263.07 Da Isoelectric Point: 6.9785
>T248400 WP_048796335.1 NZ_CP099311:4196294-4196671 [Enterobacter ludwigii]
MQTQSRSPTREASPRPSPVEIWLRLLSHLLEHHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SAETQSPLLTRIDILRARKATGLMTRNDYRTVTDITTGKYREVQQ
MQTQSRSPTREASPRPSPVEIWLRLLSHLLEHHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SAETQSPLLTRIDILRARKATGLMTRNDYRTVTDITTGKYREVQQ
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13252.16 Da Isoelectric Point: 6.4784
>AT248400 WP_249339873.1 NZ_CP099311:4195883-4196242 [Enterobacter ludwigii]
MSNEIPAVNHDIADPWWGLKRNITPCFGARLVQEGNRLHYLADRASITGQFSEADLRHLDLAFPVLMKQMELMLVSGELN
PRHQHCVTLYAKGLTCEADSLGSHGYVYIAIYPTPATTA
MSNEIPAVNHDIADPWWGLKRNITPCFGARLVQEGNRLHYLADRASITGQFSEADLRHLDLAFPVLMKQMELMLVSGELN
PRHQHCVTLYAKGLTCEADSLGSHGYVYIAIYPTPATTA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|