Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4195883..4196671 Replicon chromosome
Accession NZ_CP099311
Organism Enterobacter ludwigii strain RHB43-SE-C05

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag NFK84_RS20285 Protein ID WP_048796335.1
Coordinates 4196294..4196671 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag NFK84_RS20280 Protein ID WP_249339873.1
Coordinates 4195883..4196242 (+) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK84_RS20225 (NFK84_20210) 4191151..4191450 + 300 WP_213822536.1 hypothetical protein -
NFK84_RS20230 (NFK84_20215) 4191463..4191774 + 312 WP_279261633.1 hypothetical protein -
NFK84_RS20235 (NFK84_20220) 4191821..4192291 + 471 WP_038255738.1 hypothetical protein -
NFK84_RS20240 (NFK84_20225) 4192350..4192862 + 513 WP_279261634.1 DUF4234 domain-containing protein -
NFK84_RS20245 (NFK84_20230) 4192945..4193169 + 225 WP_038255742.1 hypothetical protein -
NFK84_RS20250 (NFK84_20235) 4193227..4193460 + 234 WP_025203175.1 DUF905 domain-containing protein -
NFK84_RS20255 (NFK84_20240) 4193552..4194370 + 819 WP_038255744.1 DUF932 domain-containing protein -
NFK84_RS20260 (NFK84_20245) 4194370..4194624 + 255 WP_072009073.1 hypothetical protein -
NFK84_RS20265 (NFK84_20250) 4194641..4195126 + 486 WP_279261635.1 antirestriction protein -
NFK84_RS20270 (NFK84_20255) 4195138..4195617 + 480 WP_279261636.1 DNA repair protein RadC -
NFK84_RS20275 (NFK84_20260) 4195638..4195859 + 222 WP_212563151.1 DUF987 domain-containing protein -
NFK84_RS20280 (NFK84_20265) 4195883..4196242 + 360 WP_249339873.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFK84_RS20285 (NFK84_20270) 4196294..4196671 + 378 WP_048796335.1 TA system toxin CbtA family protein Toxin
NFK84_RS20290 (NFK84_20275) 4196668..4197159 + 492 WP_048796334.1 DUF5983 family protein -
NFK84_RS20295 (NFK84_20280) 4197189..4197392 + 204 WP_048796333.1 DUF957 domain-containing protein -
NFK84_RS20300 (NFK84_20285) 4197475..4198320 + 846 WP_212563156.1 DUF4942 domain-containing protein -
NFK84_RS20305 (NFK84_20290) 4198758..4200023 + 1266 WP_279261639.1 integrase arm-type DNA-binding domain-containing protein -
NFK84_RS20310 (NFK84_20295) 4200281..4200640 + 360 Protein_3972 IS5 family transposase -
NFK84_RS20315 (NFK84_20300) 4200684..4201163 - 480 Protein_3973 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14263.07 Da        Isoelectric Point: 6.9785

>T248400 WP_048796335.1 NZ_CP099311:4196294-4196671 [Enterobacter ludwigii]
MQTQSRSPTREASPRPSPVEIWLRLLSHLLEHHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SAETQSPLLTRIDILRARKATGLMTRNDYRTVTDITTGKYREVQQ

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13252.16 Da        Isoelectric Point: 6.4784

>AT248400 WP_249339873.1 NZ_CP099311:4195883-4196242 [Enterobacter ludwigii]
MSNEIPAVNHDIADPWWGLKRNITPCFGARLVQEGNRLHYLADRASITGQFSEADLRHLDLAFPVLMKQMELMLVSGELN
PRHQHCVTLYAKGLTCEADSLGSHGYVYIAIYPTPATTA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References