Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4035591..4036248 | Replicon | chromosome |
| Accession | NZ_CP099311 | ||
| Organism | Enterobacter ludwigii strain RHB43-SE-C05 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | G8LDB6 |
| Locus tag | NFK84_RS19395 | Protein ID | WP_014171514.1 |
| Coordinates | 4035591..4036001 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | NFK84_RS19400 | Protein ID | WP_279261572.1 |
| Coordinates | 4035982..4036248 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK84_RS19375 (NFK84_19355) | 4031589..4033322 | - | 1734 | WP_279261571.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NFK84_RS19380 (NFK84_19360) | 4033328..4034041 | - | 714 | WP_020883731.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFK84_RS19385 (NFK84_19365) | 4034065..4034961 | - | 897 | WP_014171511.1 | site-specific tyrosine recombinase XerD | - |
| NFK84_RS19390 (NFK84_19370) | 4035063..4035584 | + | 522 | WP_014171513.1 | flavodoxin FldB | - |
| NFK84_RS19395 (NFK84_19375) | 4035591..4036001 | - | 411 | WP_014171514.1 | protein YgfX | Toxin |
| NFK84_RS19400 (NFK84_19380) | 4035982..4036248 | - | 267 | WP_279261572.1 | FAD assembly factor SdhE | Antitoxin |
| NFK84_RS19405 (NFK84_19385) | 4036543..4037523 | + | 981 | WP_020883730.1 | tRNA-modifying protein YgfZ | - |
| NFK84_RS19410 (NFK84_19390) | 4037633..4038292 | - | 660 | WP_014171517.1 | hemolysin III family protein | - |
| NFK84_RS19415 (NFK84_19395) | 4038559..4039290 | + | 732 | WP_040018863.1 | MurR/RpiR family transcriptional regulator | - |
| NFK84_RS19420 (NFK84_19400) | 4039407..4040840 | + | 1434 | WP_047743596.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16217.15 Da Isoelectric Point: 11.5020
>T248399 WP_014171514.1 NZ_CP099311:c4036001-4035591 [Enterobacter ludwigii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|