Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3811929..3812586 | Replicon | chromosome |
Accession | NZ_CP099310 | ||
Organism | Enterobacter ludwigii strain RHB28-E3-C01 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | G8LDB6 |
Locus tag | NFK33_RS18085 | Protein ID | WP_014171514.1 |
Coordinates | 3811929..3812339 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | NFK33_RS18090 | Protein ID | WP_003863437.1 |
Coordinates | 3812320..3812586 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK33_RS18065 (NFK33_18065) | 3807927..3809660 | - | 1734 | WP_044866092.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFK33_RS18070 (NFK33_18070) | 3809666..3810379 | - | 714 | WP_020883731.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFK33_RS18075 (NFK33_18075) | 3810403..3811299 | - | 897 | WP_014171511.1 | site-specific tyrosine recombinase XerD | - |
NFK33_RS18080 (NFK33_18080) | 3811401..3811922 | + | 522 | WP_014171513.1 | flavodoxin FldB | - |
NFK33_RS18085 (NFK33_18085) | 3811929..3812339 | - | 411 | WP_014171514.1 | protein YgfX | Toxin |
NFK33_RS18090 (NFK33_18090) | 3812320..3812586 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
NFK33_RS18095 (NFK33_18095) | 3812881..3813861 | + | 981 | WP_020883730.1 | tRNA-modifying protein YgfZ | - |
NFK33_RS18100 (NFK33_18100) | 3813972..3814631 | - | 660 | WP_014171517.1 | hemolysin III family protein | - |
NFK33_RS18105 (NFK33_18105) | 3814898..3815629 | + | 732 | WP_040018863.1 | MurR/RpiR family transcriptional regulator | - |
NFK33_RS18110 (NFK33_18110) | 3815746..3817179 | + | 1434 | WP_063925570.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16217.15 Da Isoelectric Point: 11.5020
>T248392 WP_014171514.1 NZ_CP099310:c3812339-3811929 [Enterobacter ludwigii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A839BUV6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |