Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1043300..1043920 | Replicon | chromosome |
| Accession | NZ_CP099310 | ||
| Organism | Enterobacter ludwigii strain RHB28-E3-C01 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | G8LPY2 |
| Locus tag | NFK33_RS04915 | Protein ID | WP_014168902.1 |
| Coordinates | 1043300..1043518 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | W0BRV6 |
| Locus tag | NFK33_RS04920 | Protein ID | WP_020885187.1 |
| Coordinates | 1043546..1043920 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK33_RS04885 (NFK33_04885) | 1039311..1039571 | + | 261 | WP_010428154.1 | type B 50S ribosomal protein L31 | - |
| NFK33_RS04890 (NFK33_04890) | 1039574..1039714 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| NFK33_RS04895 (NFK33_04895) | 1039711..1040421 | - | 711 | WP_279256708.1 | GNAT family protein | - |
| NFK33_RS04900 (NFK33_04900) | 1040522..1041982 | + | 1461 | WP_020885190.1 | PLP-dependent aminotransferase family protein | - |
| NFK33_RS04905 (NFK33_04905) | 1041954..1042421 | - | 468 | WP_020885189.1 | YlaC family protein | - |
| NFK33_RS04910 (NFK33_04910) | 1042539..1043090 | - | 552 | WP_163306289.1 | maltose O-acetyltransferase | - |
| NFK33_RS04915 (NFK33_04915) | 1043300..1043518 | - | 219 | WP_014168902.1 | HHA domain-containing protein | Toxin |
| NFK33_RS04920 (NFK33_04920) | 1043546..1043920 | - | 375 | WP_020885187.1 | Hha toxicity modulator TomB | Antitoxin |
| NFK33_RS04925 (NFK33_04925) | 1044432..1047578 | - | 3147 | WP_014168904.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NFK33_RS04930 (NFK33_04930) | 1047601..1048794 | - | 1194 | WP_020885186.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8654.04 Da Isoelectric Point: 8.9107
>T248387 WP_014168902.1 NZ_CP099310:c1043518-1043300 [Enterobacter ludwigii]
MSEKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWRFVR
MSEKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWRFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14495.31 Da Isoelectric Point: 4.8886
>AT248387 WP_020885187.1 NZ_CP099310:c1043920-1043546 [Enterobacter ludwigii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFINVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFINVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A839BM33 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5C1BX74 |