Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 484213..484729 | Replicon | chromosome |
| Accession | NZ_CP099310 | ||
| Organism | Enterobacter ludwigii strain RHB28-E3-C01 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NFK33_RS02295 | Protein ID | WP_032681845.1 |
| Coordinates | 484445..484729 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NFK33_RS02290 | Protein ID | WP_032679513.1 |
| Coordinates | 484213..484455 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK33_RS02275 (NFK33_02275) | 480210..480950 | + | 741 | WP_020882900.1 | KDGP aldolase family protein | - |
| NFK33_RS02280 (NFK33_02280) | 481069..482205 | + | 1137 | WP_032681848.1 | lactonase family protein | - |
| NFK33_RS02285 (NFK33_02285) | 482225..484135 | + | 1911 | WP_032681846.1 | PRD domain-containing protein | - |
| NFK33_RS02290 (NFK33_02290) | 484213..484455 | + | 243 | WP_032679513.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NFK33_RS02295 (NFK33_02295) | 484445..484729 | + | 285 | WP_032681845.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFK33_RS02300 (NFK33_02300) | 484733..485197 | - | 465 | WP_059306428.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NFK33_RS02305 (NFK33_02305) | 485336..487474 | - | 2139 | WP_020885401.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NFK33_RS02310 (NFK33_02310) | 487842..488414 | - | 573 | WP_279256604.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10904.66 Da Isoelectric Point: 10.1940
>T248386 WP_032681845.1 NZ_CP099310:484445-484729 [Enterobacter ludwigii]
MTYELVFDPRAFKEWTRLGDTVKNQFKKKLANVLVNPRVESARLHGLPDCDKIKLRSQGYRLVYQVQDNVVTVCVIAIGK
RENSAVYHDVNKRL
MTYELVFDPRAFKEWTRLGDTVKNQFKKKLANVLVNPRVESARLHGLPDCDKIKLRSQGYRLVYQVQDNVVTVCVIAIGK
RENSAVYHDVNKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|