Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3824791..3825448 | Replicon | chromosome |
| Accession | NZ_CP099309 | ||
| Organism | Enterobacter ludwigii strain RHB25-E3-C07 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NFK27_RS18095 | Protein ID | WP_086532137.1 |
| Coordinates | 3824791..3825201 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | NFK27_RS18100 | Protein ID | WP_003863437.1 |
| Coordinates | 3825182..3825448 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK27_RS18075 (NFK27_18070) | 3820789..3822522 | - | 1734 | WP_279259836.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NFK27_RS18080 (NFK27_18075) | 3822528..3823241 | - | 714 | WP_020883731.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFK27_RS18085 (NFK27_18080) | 3823265..3824161 | - | 897 | WP_014171511.1 | site-specific tyrosine recombinase XerD | - |
| NFK27_RS18090 (NFK27_18085) | 3824263..3824784 | + | 522 | WP_049023375.1 | flavodoxin FldB | - |
| NFK27_RS18095 (NFK27_18090) | 3824791..3825201 | - | 411 | WP_086532137.1 | protein YgfX | Toxin |
| NFK27_RS18100 (NFK27_18095) | 3825182..3825448 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| NFK27_RS18105 (NFK27_18100) | 3825743..3826723 | + | 981 | WP_032678924.1 | tRNA-modifying protein YgfZ | - |
| NFK27_RS18110 (NFK27_18105) | 3826833..3827492 | - | 660 | WP_014171517.1 | hemolysin III family protein | - |
| NFK27_RS18115 (NFK27_18110) | 3827759..3828490 | + | 732 | WP_020883729.1 | MurR/RpiR family transcriptional regulator | - |
| NFK27_RS18120 (NFK27_18115) | 3828607..3830040 | + | 1434 | WP_032678925.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16199.12 Da Isoelectric Point: 11.5020
>T248385 WP_086532137.1 NZ_CP099309:c3825201-3824791 [Enterobacter ludwigii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGLPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGLPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|