Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1018862..1019482 | Replicon | chromosome |
| Accession | NZ_CP099309 | ||
| Organism | Enterobacter ludwigii strain RHB25-E3-C07 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | G8LPY2 |
| Locus tag | NFK27_RS04785 | Protein ID | WP_014168902.1 |
| Coordinates | 1018862..1019080 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | W0BRV6 |
| Locus tag | NFK27_RS04790 | Protein ID | WP_020885187.1 |
| Coordinates | 1019108..1019482 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK27_RS04755 (NFK27_04755) | 1014873..1015133 | + | 261 | WP_010428154.1 | type B 50S ribosomal protein L31 | - |
| NFK27_RS04760 (NFK27_04760) | 1015136..1015276 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| NFK27_RS04765 (NFK27_04765) | 1015273..1015983 | - | 711 | WP_181240139.1 | GNAT family protein | - |
| NFK27_RS04770 (NFK27_04770) | 1016084..1017544 | + | 1461 | WP_279260358.1 | PLP-dependent aminotransferase family protein | - |
| NFK27_RS04775 (NFK27_04775) | 1017516..1017983 | - | 468 | WP_032677533.1 | YlaC family protein | - |
| NFK27_RS04780 (NFK27_04780) | 1018101..1018652 | - | 552 | WP_020885188.1 | maltose O-acetyltransferase | - |
| NFK27_RS04785 (NFK27_04785) | 1018862..1019080 | - | 219 | WP_014168902.1 | HHA domain-containing protein | Toxin |
| NFK27_RS04790 (NFK27_04790) | 1019108..1019482 | - | 375 | WP_020885187.1 | Hha toxicity modulator TomB | Antitoxin |
| NFK27_RS04795 (NFK27_04795) | 1019994..1023140 | - | 3147 | WP_014168904.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NFK27_RS04800 (NFK27_04800) | 1023163..1024356 | - | 1194 | WP_020885186.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8654.04 Da Isoelectric Point: 8.9107
>T248379 WP_014168902.1 NZ_CP099309:c1019080-1018862 [Enterobacter ludwigii]
MSEKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWRFVR
MSEKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWRFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14495.31 Da Isoelectric Point: 4.8886
>AT248379 WP_020885187.1 NZ_CP099309:c1019482-1019108 [Enterobacter ludwigii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFINVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFINVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A839BM33 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5C1BX74 |