Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3871863..3872520 | Replicon | chromosome |
Accession | NZ_CP099308 | ||
Organism | Enterobacter roggenkampii strain RHB21-E1-C01 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
Locus tag | NFK08_RS18615 | Protein ID | WP_021242050.1 |
Coordinates | 3871863..3872273 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W7NX65 |
Locus tag | NFK08_RS18620 | Protein ID | WP_006178375.1 |
Coordinates | 3872254..3872520 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK08_RS18595 (NFK08_18590) | 3867856..3869589 | - | 1734 | WP_045351724.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFK08_RS18600 (NFK08_18595) | 3869595..3870308 | - | 714 | WP_008499708.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFK08_RS18605 (NFK08_18600) | 3870337..3871233 | - | 897 | WP_008499709.1 | site-specific tyrosine recombinase XerD | - |
NFK08_RS18610 (NFK08_18605) | 3871335..3871856 | + | 522 | WP_008499710.1 | flavodoxin FldB | - |
NFK08_RS18615 (NFK08_18610) | 3871863..3872273 | - | 411 | WP_021242050.1 | protein YgfX | Toxin |
NFK08_RS18620 (NFK08_18615) | 3872254..3872520 | - | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
NFK08_RS18625 (NFK08_18620) | 3872815..3873795 | + | 981 | WP_047745992.1 | tRNA-modifying protein YgfZ | - |
NFK08_RS18630 (NFK08_18625) | 3873880..3874539 | - | 660 | WP_032664328.1 | hemolysin III family protein | - |
NFK08_RS18635 (NFK08_18630) | 3874805..3875536 | + | 732 | WP_021242053.1 | MurR/RpiR family transcriptional regulator | - |
NFK08_RS18640 (NFK08_18635) | 3875653..3877086 | + | 1434 | WP_008499715.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T248377 WP_021242050.1 NZ_CP099308:c3872273-3871863 [Enterobacter roggenkampii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W7NX65 |