Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1038164..1038784 | Replicon | chromosome |
Accession | NZ_CP099308 | ||
Organism | Enterobacter roggenkampii strain RHB21-E1-C01 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A1H8SI38 |
Locus tag | NFK08_RS04860 | Protein ID | WP_008499287.1 |
Coordinates | 1038164..1038382 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | NFK08_RS04865 | Protein ID | WP_008499288.1 |
Coordinates | 1038410..1038784 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK08_RS04830 (NFK08_04830) | 1034177..1034437 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
NFK08_RS04835 (NFK08_04835) | 1034440..1034580 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
NFK08_RS04840 (NFK08_04840) | 1034577..1035287 | - | 711 | WP_248199361.1 | GNAT family protein | - |
NFK08_RS04845 (NFK08_04845) | 1035389..1036849 | + | 1461 | WP_248199358.1 | PLP-dependent aminotransferase family protein | - |
NFK08_RS04850 (NFK08_04850) | 1036821..1037288 | - | 468 | WP_008499285.1 | YlaC family protein | - |
NFK08_RS04855 (NFK08_04855) | 1037406..1037957 | - | 552 | WP_248199355.1 | maltose O-acetyltransferase | - |
NFK08_RS04860 (NFK08_04860) | 1038164..1038382 | - | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
NFK08_RS04865 (NFK08_04865) | 1038410..1038784 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
NFK08_RS04870 (NFK08_04870) | 1039294..1042440 | - | 3147 | WP_008499289.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NFK08_RS04875 (NFK08_04875) | 1042463..1043656 | - | 1194 | WP_021241633.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T248372 WP_008499287.1 NZ_CP099308:c1038382-1038164 [Enterobacter roggenkampii]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT248372 WP_008499288.1 NZ_CP099308:c1038784-1038410 [Enterobacter roggenkampii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H8SI38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |