Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 241576..242172 | Replicon | chromosome |
Accession | NZ_CP099308 | ||
Organism | Enterobacter roggenkampii strain RHB21-E1-C01 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A0F1DED9 |
Locus tag | NFK08_RS01090 | Protein ID | WP_023293553.1 |
Coordinates | 241870..242172 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A837LKY9 |
Locus tag | NFK08_RS01085 | Protein ID | WP_044598004.1 |
Coordinates | 241576..241863 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK08_RS01080 (NFK08_01080) | 239948..241579 | + | 1632 | WP_008503411.1 | Na/Pi cotransporter family protein | - |
NFK08_RS01085 (NFK08_01085) | 241576..241863 | - | 288 | WP_044598004.1 | putative addiction module antidote protein | Antitoxin |
NFK08_RS01090 (NFK08_01090) | 241870..242172 | - | 303 | WP_023293553.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFK08_RS01095 (NFK08_01095) | 242370..243242 | + | 873 | WP_248199460.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
NFK08_RS01100 (NFK08_01100) | 243243..243515 | - | 273 | WP_014830263.1 | DUF3811 domain-containing protein | - |
NFK08_RS01105 (NFK08_01105) | 243566..244510 | - | 945 | WP_023293551.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
NFK08_RS01110 (NFK08_01110) | 244616..246190 | - | 1575 | WP_032675767.1 | RNA repair transcriptional activator RtcR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11459.24 Da Isoelectric Point: 10.1771
>T248371 WP_023293553.1 NZ_CP099308:c242172-241870 [Enterobacter roggenkampii]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F1DED9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837LKY9 |