Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 5212194..5212770 | Replicon | chromosome |
Accession | NZ_CP099306 | ||
Organism | Klebsiella michiganensis strain RHB20-SO-C01 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | NFK05_RS24545 | Protein ID | WP_064375702.1 |
Coordinates | 5212483..5212770 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A0H3H591 |
Locus tag | NFK05_RS24540 | Protein ID | WP_014227757.1 |
Coordinates | 5212194..5212496 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK05_RS24525 (NFK05_24500) | 5209035..5209370 | + | 336 | WP_064375703.1 | endoribonuclease SymE | - |
NFK05_RS24530 (NFK05_24505) | 5209822..5210733 | + | 912 | WP_181251267.1 | acetamidase/formamidase family protein | - |
NFK05_RS24535 (NFK05_24510) | 5210730..5212073 | + | 1344 | WP_049101852.1 | APC family permease | - |
NFK05_RS24540 (NFK05_24515) | 5212194..5212496 | - | 303 | WP_014227757.1 | BrnA antitoxin family protein | Antitoxin |
NFK05_RS24545 (NFK05_24520) | 5212483..5212770 | - | 288 | WP_064375702.1 | BrnT family toxin | Toxin |
NFK05_RS24550 (NFK05_24525) | 5213018..5213461 | - | 444 | WP_064375701.1 | FosA family fosfomycin resistance glutathione transferase | - |
NFK05_RS24555 (NFK05_24530) | 5213455..5214363 | - | 909 | WP_064375700.1 | LysR family transcriptional regulator | - |
NFK05_RS24560 (NFK05_24535) | 5214451..5215233 | + | 783 | WP_181251268.1 | NAD(P)H-dependent oxidoreductase | - |
NFK05_RS24565 (NFK05_24540) | 5215381..5215965 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
NFK05_RS24570 (NFK05_24545) | 5216111..5216911 | + | 801 | WP_064375698.1 | helix-turn-helix domain-containing protein | - |
NFK05_RS24575 (NFK05_24550) | 5216908..5217426 | + | 519 | WP_004098240.1 | FidL-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11210.69 Da Isoelectric Point: 7.4687
>T248367 WP_064375702.1 NZ_CP099306:c5212770-5212483 [Klebsiella michiganensis]
MPMEFEWDANKAISNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTLGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKAISNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTLGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|