Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4536620..4537239 Replicon chromosome
Accession NZ_CP099306
Organism Klebsiella michiganensis strain RHB20-SO-C01

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag NFK05_RS21435 Protein ID WP_004099646.1
Coordinates 4537021..4537239 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A0J2I7Z1
Locus tag NFK05_RS21430 Protein ID WP_025107145.1
Coordinates 4536620..4536994 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK05_RS21420 (NFK05_21400) 4531776..4532969 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NFK05_RS21425 (NFK05_21405) 4532992..4536138 + 3147 WP_032748290.1 multidrug efflux RND transporter permease subunit AcrB -
NFK05_RS21430 (NFK05_21410) 4536620..4536994 + 375 WP_025107145.1 Hha toxicity modulator TomB Antitoxin
NFK05_RS21435 (NFK05_21415) 4537021..4537239 + 219 WP_004099646.1 HHA domain-containing protein Toxin
NFK05_RS21440 (NFK05_21420) 4537402..4537968 + 567 WP_032748289.1 maltose O-acetyltransferase -
NFK05_RS21445 (NFK05_21425) 4537940..4538074 - 135 WP_228728078.1 hypothetical protein -
NFK05_RS21450 (NFK05_21430) 4538095..4538565 + 471 WP_014228205.1 YlaC family protein -
NFK05_RS21455 (NFK05_21435) 4538540..4539994 - 1455 WP_032748288.1 PLP-dependent aminotransferase family protein -
NFK05_RS21460 (NFK05_21440) 4540096..4540794 + 699 WP_048261453.1 GNAT family protein -
NFK05_RS21465 (NFK05_21445) 4540791..4540931 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
NFK05_RS21470 (NFK05_21450) 4540931..4541194 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-115)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T248365 WP_004099646.1 NZ_CP099306:4537021-4537239 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14366.15 Da        Isoelectric Point: 4.8989

>AT248365 WP_025107145.1 NZ_CP099306:4536620-4536994 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0J2I7Z1

References