Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 873512..874169 | Replicon | chromosome |
| Accession | NZ_CP099306 | ||
| Organism | Klebsiella michiganensis strain RHB20-SO-C01 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | J5U333 |
| Locus tag | NFK05_RS04210 | Protein ID | WP_004854060.1 |
| Coordinates | 873759..874169 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | H3N295 |
| Locus tag | NFK05_RS04205 | Protein ID | WP_004124953.1 |
| Coordinates | 873512..873778 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK05_RS04190 (NFK05_04190) | 868746..869171 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
| NFK05_RS04195 (NFK05_04195) | 869292..872090 | - | 2799 | WP_049079129.1 | transcriptional regulator DagR | - |
| NFK05_RS04200 (NFK05_04200) | 872284..873267 | - | 984 | WP_181251431.1 | tRNA-modifying protein YgfZ | - |
| NFK05_RS04205 (NFK05_04205) | 873512..873778 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
| NFK05_RS04210 (NFK05_04210) | 873759..874169 | + | 411 | WP_004854060.1 | protein YgfX | Toxin |
| NFK05_RS04215 (NFK05_04215) | 874178..874699 | - | 522 | WP_143440241.1 | flavodoxin FldB | - |
| NFK05_RS04220 (NFK05_04220) | 874821..875717 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
| NFK05_RS04225 (NFK05_04225) | 875740..876453 | + | 714 | WP_064381439.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFK05_RS04230 (NFK05_04230) | 876459..878192 | + | 1734 | WP_032751182.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16106.97 Da Isoelectric Point: 10.9455
>T248359 WP_004854060.1 NZ_CP099306:873759-874169 [Klebsiella michiganensis]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYA5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H3L9 |