Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 5268603..5269391 Replicon chromosome
Accession NZ_CP099304
Organism Klebsiella michiganensis strain RHB20-SO-C02

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag NFK06_RS24810 Protein ID WP_040246536.1
Coordinates 5268603..5268980 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag NFK06_RS24815 Protein ID WP_040246534.1
Coordinates 5269032..5269391 (-) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK06_RS24775 (NFK06_24750) 5264029..5264352 + 324 WP_080528469.1 endoribonuclease SymE -
NFK06_RS24780 (NFK06_24755) 5264511..5264945 + 435 WP_004098173.1 VOC family protein -
NFK06_RS24785 (NFK06_24760) 5265111..5265854 + 744 WP_181251272.1 hypothetical protein -
NFK06_RS24790 (NFK06_24765) 5266032..5266829 - 798 WP_047684029.1 helix-turn-helix transcriptional regulator -
NFK06_RS24795 (NFK06_24770) 5266973..5267818 - 846 WP_181251273.1 DUF4942 domain-containing protein -
NFK06_RS24800 (NFK06_24775) 5267900..5268085 - 186 WP_047684023.1 DUF957 domain-containing protein -
NFK06_RS24805 (NFK06_24780) 5268115..5268606 - 492 WP_047684020.1 DUF5983 family protein -
NFK06_RS24810 (NFK06_24785) 5268603..5268980 - 378 WP_040246536.1 TA system toxin CbtA family protein Toxin
NFK06_RS24815 (NFK06_24790) 5269032..5269391 - 360 WP_040246534.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFK06_RS24820 (NFK06_24795) 5269414..5269635 - 222 WP_040246532.1 DUF987 domain-containing protein -
NFK06_RS24825 (NFK06_24800) 5269656..5270135 - 480 WP_040246529.1 DNA repair protein RadC -
NFK06_RS24830 (NFK06_24805) 5270147..5270617 - 471 WP_134897158.1 antirestriction protein -
NFK06_RS24835 (NFK06_24810) 5270857..5271048 - 192 WP_077256557.1 DUF905 family protein -
NFK06_RS24840 (NFK06_24815) 5271104..5271325 - 222 WP_047684010.1 hypothetical protein -
NFK06_RS24845 (NFK06_24820) 5271399..5271869 - 471 WP_094963531.1 hypothetical protein -
NFK06_RS24850 (NFK06_24825) 5271921..5272232 - 312 WP_134897160.1 hypothetical protein -
NFK06_RS24855 (NFK06_24830) 5272290..5272592 - 303 WP_134897161.1 hypothetical protein -
NFK06_RS24860 (NFK06_24835) 5272625..5273062 - 438 WP_134897162.1 hypothetical protein -
NFK06_RS24865 (NFK06_24840) 5273076..5273786 - 711 WP_047684001.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 5264511..5332778 68267


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14021.73 Da        Isoelectric Point: 5.5540

>T248357 WP_040246536.1 NZ_CP099304:c5268980-5268603 [Klebsiella michiganensis]
MQTQPLSSTQEASPRPSQVDIWQQLLSHLLDRHYGLTLNDTPFGHDGVIQEHIDAGISLCDAVNVIVEKYDLVRTDRPGF
SAETQSPLISSIDILRARKATGLMTRNDYRTVTDITTGKYREVQP

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13035.78 Da        Isoelectric Point: 5.8062

>AT248357 WP_040246534.1 NZ_CP099304:c5269391-5269032 [Klebsiella michiganensis]
MSNEIPAVNHDIAEPWWGLKPTVTPCFGARLVQEGNQVHYLADRASITGQFSEADLRHLDQAFPVLLKQLELMLVSGELN
PHHQHGVTLYAKGLTCEADSLGSHGYIYIAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References