Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 5212084..5212660 | Replicon | chromosome |
| Accession | NZ_CP099304 | ||
| Organism | Klebsiella michiganensis strain RHB20-SO-C02 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | NFK06_RS24540 | Protein ID | WP_064375702.1 |
| Coordinates | 5212373..5212660 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A0H3H591 |
| Locus tag | NFK06_RS24535 | Protein ID | WP_014227757.1 |
| Coordinates | 5212084..5212386 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK06_RS24520 (NFK06_24495) | 5208925..5209260 | + | 336 | WP_064375703.1 | endoribonuclease SymE | - |
| NFK06_RS24525 (NFK06_24500) | 5209712..5210623 | + | 912 | WP_181251267.1 | acetamidase/formamidase family protein | - |
| NFK06_RS24530 (NFK06_24505) | 5210620..5211963 | + | 1344 | WP_049101852.1 | APC family permease | - |
| NFK06_RS24535 (NFK06_24510) | 5212084..5212386 | - | 303 | WP_014227757.1 | BrnA antitoxin family protein | Antitoxin |
| NFK06_RS24540 (NFK06_24515) | 5212373..5212660 | - | 288 | WP_064375702.1 | BrnT family toxin | Toxin |
| NFK06_RS24545 (NFK06_24520) | 5212908..5213351 | - | 444 | WP_064375701.1 | FosA family fosfomycin resistance glutathione transferase | - |
| NFK06_RS24550 (NFK06_24525) | 5213345..5214253 | - | 909 | WP_064375700.1 | LysR family transcriptional regulator | - |
| NFK06_RS24555 (NFK06_24530) | 5214341..5215123 | + | 783 | WP_181251268.1 | NAD(P)H-dependent oxidoreductase | - |
| NFK06_RS24560 (NFK06_24535) | 5215271..5215855 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
| NFK06_RS24565 (NFK06_24540) | 5216001..5216801 | + | 801 | WP_064375698.1 | helix-turn-helix domain-containing protein | - |
| NFK06_RS24570 (NFK06_24545) | 5216798..5217316 | + | 519 | WP_004098240.1 | FidL-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11210.69 Da Isoelectric Point: 7.4687
>T248356 WP_064375702.1 NZ_CP099304:c5212660-5212373 [Klebsiella michiganensis]
MPMEFEWDANKAISNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTLGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKAISNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTLGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|