Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4536510..4537129 Replicon chromosome
Accession NZ_CP099304
Organism Klebsiella michiganensis strain RHB20-SO-C02

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag NFK06_RS21430 Protein ID WP_004099646.1
Coordinates 4536911..4537129 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A0J2I7Z1
Locus tag NFK06_RS21425 Protein ID WP_025107145.1
Coordinates 4536510..4536884 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK06_RS21415 (NFK06_21395) 4531666..4532859 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NFK06_RS21420 (NFK06_21400) 4532882..4536028 + 3147 WP_032748290.1 multidrug efflux RND transporter permease subunit AcrB -
NFK06_RS21425 (NFK06_21405) 4536510..4536884 + 375 WP_025107145.1 Hha toxicity modulator TomB Antitoxin
NFK06_RS21430 (NFK06_21410) 4536911..4537129 + 219 WP_004099646.1 HHA domain-containing protein Toxin
NFK06_RS21435 (NFK06_21415) 4537292..4537858 + 567 WP_032748289.1 maltose O-acetyltransferase -
NFK06_RS21440 (NFK06_21420) 4537830..4537964 - 135 WP_228728078.1 hypothetical protein -
NFK06_RS21445 (NFK06_21425) 4537985..4538455 + 471 WP_014228205.1 YlaC family protein -
NFK06_RS21450 (NFK06_21430) 4538430..4539884 - 1455 WP_032748288.1 PLP-dependent aminotransferase family protein -
NFK06_RS21455 (NFK06_21435) 4539986..4540684 + 699 WP_048261453.1 GNAT family protein -
NFK06_RS21460 (NFK06_21440) 4540681..4540821 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
NFK06_RS21465 (NFK06_21445) 4540821..4541084 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-115)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T248354 WP_004099646.1 NZ_CP099304:4536911-4537129 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14366.15 Da        Isoelectric Point: 4.8989

>AT248354 WP_025107145.1 NZ_CP099304:4536510-4536884 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0J2I7Z1

References