Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4536510..4537129 | Replicon | chromosome |
| Accession | NZ_CP099304 | ||
| Organism | Klebsiella michiganensis strain RHB20-SO-C02 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3N9D8 |
| Locus tag | NFK06_RS21430 | Protein ID | WP_004099646.1 |
| Coordinates | 4536911..4537129 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A0J2I7Z1 |
| Locus tag | NFK06_RS21425 | Protein ID | WP_025107145.1 |
| Coordinates | 4536510..4536884 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK06_RS21415 (NFK06_21395) | 4531666..4532859 | + | 1194 | WP_004136054.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFK06_RS21420 (NFK06_21400) | 4532882..4536028 | + | 3147 | WP_032748290.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NFK06_RS21425 (NFK06_21405) | 4536510..4536884 | + | 375 | WP_025107145.1 | Hha toxicity modulator TomB | Antitoxin |
| NFK06_RS21430 (NFK06_21410) | 4536911..4537129 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
| NFK06_RS21435 (NFK06_21415) | 4537292..4537858 | + | 567 | WP_032748289.1 | maltose O-acetyltransferase | - |
| NFK06_RS21440 (NFK06_21420) | 4537830..4537964 | - | 135 | WP_228728078.1 | hypothetical protein | - |
| NFK06_RS21445 (NFK06_21425) | 4537985..4538455 | + | 471 | WP_014228205.1 | YlaC family protein | - |
| NFK06_RS21450 (NFK06_21430) | 4538430..4539884 | - | 1455 | WP_032748288.1 | PLP-dependent aminotransferase family protein | - |
| NFK06_RS21455 (NFK06_21435) | 4539986..4540684 | + | 699 | WP_048261453.1 | GNAT family protein | - |
| NFK06_RS21460 (NFK06_21440) | 4540681..4540821 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| NFK06_RS21465 (NFK06_21445) | 4540821..4541084 | - | 264 | WP_004848323.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T248354 WP_004099646.1 NZ_CP099304:4536911-4537129 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14366.15 Da Isoelectric Point: 4.8989
>AT248354 WP_025107145.1 NZ_CP099304:4536510-4536884 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H713 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2I7Z1 |