Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2080607..2081197 | Replicon | chromosome |
Accession | NZ_CP099304 | ||
Organism | Klebsiella michiganensis strain RHB20-SO-C02 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A7H5AAK0 |
Locus tag | NFK06_RS09725 | Protein ID | WP_004852304.1 |
Coordinates | 2080865..2081197 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | J6I3K7 |
Locus tag | NFK06_RS09720 | Protein ID | WP_004852307.1 |
Coordinates | 2080607..2080864 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK06_RS09710 (NFK06_09710) | 2079915..2080224 | + | 310 | Protein_1904 | hypothetical protein | - |
NFK06_RS09715 (NFK06_09715) | 2080227..2080346 | + | 120 | Protein_1905 | helix-turn-helix domain-containing protein | - |
NFK06_RS09720 (NFK06_09720) | 2080607..2080864 | + | 258 | WP_004852307.1 | antitoxin | Antitoxin |
NFK06_RS09725 (NFK06_09725) | 2080865..2081197 | + | 333 | WP_004852304.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NFK06_RS09735 (NFK06_09735) | 2081520..2082977 | + | 1458 | WP_049079573.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
NFK06_RS09745 (NFK06_09745) | 2083941..2085395 | - | 1455 | WP_134897790.1 | AMP nucleosidase | - |
NFK06_RS09750 (NFK06_09750) | 2085528..2085785 | - | 258 | WP_014229908.1 | histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11863.81 Da Isoelectric Point: 10.5834
>T248349 WP_004852304.1 NZ_CP099304:2080865-2081197 [Klebsiella michiganensis]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGIKTLGVIRCDQPRTI
DMTARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGIKTLGVIRCDQPRTI
DMTARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H5AAK0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3HDW8 |