Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4622809..4623425 | Replicon | chromosome |
Accession | NZ_CP099303 | ||
Organism | Citrobacter freundii strain RHB02-E1-C01 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
Locus tag | NFJ16_RS21980 | Protein ID | WP_003028682.1 |
Coordinates | 4622809..4623183 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
Locus tag | NFJ16_RS21985 | Protein ID | WP_043018956.1 |
Coordinates | 4623183..4623425 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ16_RS21965 (4620312) | 4620312..4621214 | + | 903 | WP_003847898.1 | formate dehydrogenase O subunit beta | - |
NFJ16_RS21970 (4621211) | 4621211..4621846 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFJ16_RS21975 (4621843) | 4621843..4622772 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
NFJ16_RS21980 (4622809) | 4622809..4623183 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFJ16_RS21985 (4623183) | 4623183..4623425 | - | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
NFJ16_RS21990 (4623631) | 4623631..4624539 | + | 909 | WP_003847901.1 | alpha/beta hydrolase | - |
NFJ16_RS21995 (4624690) | 4624690..4625631 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
NFJ16_RS22000 (4625676) | 4625676..4626113 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
NFJ16_RS22005 (4626110) | 4626110..4626982 | - | 873 | WP_003028669.1 | virulence factor BrkB family protein | - |
NFJ16_RS22010 (4626976) | 4626976..4627575 | - | 600 | WP_003028663.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T248346 WP_003028682.1 NZ_CP099303:c4623183-4622809 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MQ96 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B5NTK4 |