Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4471281..4471947 | Replicon | chromosome |
Accession | NZ_CP099303 | ||
Organism | Citrobacter freundii strain RHB02-E1-C01 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | NFJ16_RS21295 | Protein ID | WP_048216973.1 |
Coordinates | 4471588..4471947 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | A0A0J1QJH0 |
Locus tag | NFJ16_RS21290 | Protein ID | WP_032938223.1 |
Coordinates | 4471281..4471598 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ16_RS21255 (4466460) | 4466460..4467257 | + | 798 | WP_003841402.1 | PTS mannose/fructose/sorbose transporter subunit IIC | - |
NFJ16_RS21260 (4467269) | 4467269..4468093 | + | 825 | WP_048216971.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
NFJ16_RS21265 (4468161) | 4468161..4469384 | + | 1224 | WP_003031639.1 | L-sorbose 1-phosphate reductase | - |
NFJ16_RS21270 (4469386) | 4469386..4470198 | + | 813 | WP_048216972.1 | shikimate 5-dehydrogenase | - |
NFJ16_RS21275 (4470248) | 4470248..4470604 | - | 357 | WP_032938220.1 | hypothetical protein | - |
NFJ16_RS21280 (4470736) | 4470736..4470909 | + | 174 | WP_032938222.1 | hypothetical protein | - |
NFJ16_RS21285 (4470980) | 4470980..4471141 | + | 162 | WP_003841416.1 | phage protein | - |
NFJ16_RS21290 (4471281) | 4471281..4471598 | - | 318 | WP_032938223.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NFJ16_RS21295 (4471588) | 4471588..4471947 | - | 360 | WP_048216973.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ16_RS21300 (4472161) | 4472161..4472850 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
NFJ16_RS21305 (4472916) | 4472916..4474547 | - | 1632 | WP_003031618.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13410.46 Da Isoelectric Point: 10.2555
>T248345 WP_048216973.1 NZ_CP099303:c4471947-4471588 [Citrobacter freundii]
MTKPLYWVGQARKDLLAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
MTKPLYWVGQARKDLLAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|