Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4217464..4217980 | Replicon | chromosome |
Accession | NZ_CP099303 | ||
Organism | Citrobacter freundii strain RHB02-E1-C01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NFJ16_RS20090 | Protein ID | WP_048216920.1 |
Coordinates | 4217464..4217748 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | NFJ16_RS20095 | Protein ID | WP_003839576.1 |
Coordinates | 4217738..4217980 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ16_RS20075 (4213789) | 4213789..4214373 | + | 585 | WP_003839584.1 | fructose PTS transporter subunit IIA | - |
NFJ16_RS20080 (4214751) | 4214751..4216889 | + | 2139 | WP_003839582.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NFJ16_RS20085 (4216996) | 4216996..4217460 | + | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NFJ16_RS20090 (4217464) | 4217464..4217748 | - | 285 | WP_048216920.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ16_RS20095 (4217738) | 4217738..4217980 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NFJ16_RS20100 (4218058) | 4218058..4219971 | - | 1914 | WP_048241736.1 | BglG family transcription antiterminator | - |
NFJ16_RS20105 (4219993) | 4219993..4220733 | - | 741 | WP_129622263.1 | KDGP aldolase family protein | - |
NFJ16_RS20110 (4220730) | 4220730..4221848 | - | 1119 | WP_048216923.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NFJ16_RS20115 (4221832) | 4221832..4222965 | - | 1134 | WP_048216924.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10905.80 Da Isoelectric Point: 10.1715
>T248344 WP_048216920.1 NZ_CP099303:c4217748-4217464 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDKVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDKVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|