Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 3730201..3730907 | Replicon | chromosome |
Accession | NZ_CP099303 | ||
Organism | Citrobacter freundii strain RHB02-E1-C01 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | NFJ16_RS17835 | Protein ID | WP_039556156.1 |
Coordinates | 3730201..3730569 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | NFJ16_RS17840 | Protein ID | WP_039556157.1 |
Coordinates | 3730590..3730907 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ16_RS17820 (3725340) | 3725340..3726791 | + | 1452 | WP_003838742.1 | Na+/H+ antiporter NhaC | - |
NFJ16_RS17825 (3726804) | 3726804..3727985 | + | 1182 | WP_003838744.1 | MalY/PatB family protein | - |
NFJ16_RS17830 (3728151) | 3728151..3729629 | - | 1479 | WP_032941279.1 | hypothetical protein | - |
NFJ16_RS17835 (3730201) | 3730201..3730569 | - | 369 | WP_039556156.1 | TA system toxin CbtA family protein | Toxin |
NFJ16_RS17840 (3730590) | 3730590..3730907 | - | 318 | WP_039556157.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NFJ16_RS17845 (3730926) | 3730926..3731143 | - | 218 | Protein_3494 | DUF987 family protein | - |
NFJ16_RS17850 (3731152) | 3731152..3731634 | - | 483 | WP_039556158.1 | DNA repair protein RadC | - |
NFJ16_RS17855 (3731643) | 3731643..3732086 | - | 444 | WP_096164809.1 | antirestriction protein | - |
NFJ16_RS17860 (3732117) | 3732117..3732938 | - | 822 | WP_058647033.1 | DUF932 domain-containing protein | - |
NFJ16_RS17865 (3733058) | 3733058..3733531 | - | 474 | WP_058647034.1 | hypothetical protein | - |
NFJ16_RS17870 (3733603) | 3733603..3734055 | - | 453 | WP_089586936.1 | hypothetical protein | - |
NFJ16_RS17875 (3734091) | 3734091..3734807 | - | 717 | WP_058647035.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3721066..3731143 | 10077 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13715.99 Da Isoelectric Point: 8.7174
>T248342 WP_039556156.1 NZ_CP099303:c3730569-3730201 [Citrobacter freundii]
MKTLPATISRATKPCLSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETIIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQVQAPYLTATDILQARKACGLMSRCSYREVSNIVLSRSRL
MKTLPATISRATKPCLSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETIIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQVQAPYLTATDILQARKACGLMSRCSYREVSNIVLSRSRL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|