Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3520299..3520919 | Replicon | chromosome |
| Accession | NZ_CP099303 | ||
| Organism | Citrobacter freundii strain RHB02-E1-C01 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NFJ16_RS16885 | Protein ID | WP_002892050.1 |
| Coordinates | 3520701..3520919 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | NFJ16_RS16880 | Protein ID | WP_003021733.1 |
| Coordinates | 3520299..3520673 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ16_RS16870 (3515445) | 3515445..3516638 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFJ16_RS16875 (3516661) | 3516661..3519810 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
| NFJ16_RS16880 (3520299) | 3520299..3520673 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| NFJ16_RS16885 (3520701) | 3520701..3520919 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NFJ16_RS16890 (3521226) | 3521226..3521777 | + | 552 | WP_032936967.1 | maltose O-acetyltransferase | - |
| NFJ16_RS16895 (3521894) | 3521894..3522364 | + | 471 | WP_003021724.1 | YlaC family protein | - |
| NFJ16_RS16900 (3522443) | 3522443..3522583 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| NFJ16_RS16905 (3522585) | 3522585..3522845 | - | 261 | WP_003835926.1 | type B 50S ribosomal protein L31 | - |
| NFJ16_RS16910 (3523034) | 3523034..3524587 | + | 1554 | WP_048241431.1 | EAL domain-containing protein | - |
| NFJ16_RS16915 (3524639) | 3524639..3524992 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
| NFJ16_RS16920 (3525057) | 3525057..3525686 | - | 630 | WP_003835929.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248341 WP_002892050.1 NZ_CP099303:3520701-3520919 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248341 WP_003021733.1 NZ_CP099303:3520299-3520673 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |