Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 805672..806326 | Replicon | chromosome |
Accession | NZ_CP099303 | ||
Organism | Citrobacter freundii strain RHB02-E1-C01 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
Locus tag | NFJ16_RS03925 | Protein ID | WP_003026936.1 |
Coordinates | 805919..806326 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A6H3AT26 |
Locus tag | NFJ16_RS03920 | Protein ID | WP_003026938.1 |
Coordinates | 805672..805938 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ16_RS03895 (800873) | 800873..802306 | - | 1434 | WP_048217186.1 | 6-phospho-beta-glucosidase BglA | - |
NFJ16_RS03900 (802427) | 802427..803155 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
NFJ16_RS03905 (803208) | 803208..803519 | + | 312 | WP_003026949.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ16_RS03910 (803682) | 803682..804341 | + | 660 | WP_003838267.1 | hemolysin III family protein | - |
NFJ16_RS03915 (804435) | 804435..805415 | - | 981 | WP_003838269.1 | tRNA-modifying protein YgfZ | - |
NFJ16_RS03920 (805672) | 805672..805938 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
NFJ16_RS03925 (805919) | 805919..806326 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
NFJ16_RS03930 (806371) | 806371..806892 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
NFJ16_RS03935 (807006) | 807006..807902 | + | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
NFJ16_RS03940 (807926) | 807926..808639 | + | 714 | WP_003825520.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ16_RS03945 (808645) | 808645..810378 | + | 1734 | WP_032937435.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T248335 WP_003026936.1 NZ_CP099303:805919-806326 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NHY7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AT26 |