Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 276740..277326 Replicon chromosome
Accession NZ_CP099303
Organism Citrobacter freundii strain RHB02-E1-C01

Toxin (Protein)


Gene name doc Uniprot ID A0A0J1QS94
Locus tag NFJ16_RS01310 Protein ID WP_032937237.1
Coordinates 276958..277326 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0J1N092
Locus tag NFJ16_RS01305 Protein ID WP_032937236.1
Coordinates 276740..276961 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ16_RS01280 (272539) 272539..273465 + 927 WP_003023435.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NFJ16_RS01285 (273462) 273462..274739 + 1278 WP_032950432.1 branched chain amino acid ABC transporter permease LivM -
NFJ16_RS01290 (274736) 274736..275503 + 768 WP_003023438.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NFJ16_RS01295 (275521) 275521..276234 + 714 WP_003827581.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NFJ16_RS01300 (276337) 276337..276618 + 282 WP_003023442.1 hypothetical protein -
NFJ16_RS01305 (276740) 276740..276961 + 222 WP_032937236.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NFJ16_RS01310 (276958) 276958..277326 + 369 WP_032937237.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NFJ16_RS01315 (277570) 277570..278886 + 1317 WP_003023445.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NFJ16_RS01320 (278987) 278987..279874 + 888 WP_032937238.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NFJ16_RS01325 (279871) 279871..280716 + 846 WP_003023450.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NFJ16_RS01330 (280719) 280719..281789 + 1071 WP_003837845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 273462..282529 9067


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13617.91 Da        Isoelectric Point: 6.9891

>T248334 WP_032937237.1 NZ_CP099303:276958-277326 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8306.41 Da        Isoelectric Point: 4.7906

>AT248334 WP_032937236.1 NZ_CP099303:276740-276961 [Citrobacter freundii]
MRTMNYSEARQNLAEVLESAVTGVPVTITRRGHKPAVIISAEEFERYQAARLDDEFADIMMIHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J1QS94

Antitoxin

Source ID Structure
AlphaFold DB A0A0J1N092

References