Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 276740..277326 | Replicon | chromosome |
| Accession | NZ_CP099303 | ||
| Organism | Citrobacter freundii strain RHB02-E1-C01 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A0J1QS94 |
| Locus tag | NFJ16_RS01310 | Protein ID | WP_032937237.1 |
| Coordinates | 276958..277326 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A0J1N092 |
| Locus tag | NFJ16_RS01305 | Protein ID | WP_032937236.1 |
| Coordinates | 276740..276961 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ16_RS01280 (272539) | 272539..273465 | + | 927 | WP_003023435.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NFJ16_RS01285 (273462) | 273462..274739 | + | 1278 | WP_032950432.1 | branched chain amino acid ABC transporter permease LivM | - |
| NFJ16_RS01290 (274736) | 274736..275503 | + | 768 | WP_003023438.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NFJ16_RS01295 (275521) | 275521..276234 | + | 714 | WP_003827581.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NFJ16_RS01300 (276337) | 276337..276618 | + | 282 | WP_003023442.1 | hypothetical protein | - |
| NFJ16_RS01305 (276740) | 276740..276961 | + | 222 | WP_032937236.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NFJ16_RS01310 (276958) | 276958..277326 | + | 369 | WP_032937237.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NFJ16_RS01315 (277570) | 277570..278886 | + | 1317 | WP_003023445.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NFJ16_RS01320 (278987) | 278987..279874 | + | 888 | WP_032937238.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NFJ16_RS01325 (279871) | 279871..280716 | + | 846 | WP_003023450.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NFJ16_RS01330 (280719) | 280719..281789 | + | 1071 | WP_003837845.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 273462..282529 | 9067 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13617.91 Da Isoelectric Point: 6.9891
>T248334 WP_032937237.1 NZ_CP099303:276958-277326 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1QS94 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1N092 |