Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4921175..4921791 | Replicon | chromosome |
| Accession | NZ_CP099298 | ||
| Organism | Citrobacter freundii strain RHB02-E3-C01 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
| Locus tag | NFJ20_RS23675 | Protein ID | WP_003028682.1 |
| Coordinates | 4921175..4921549 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
| Locus tag | NFJ20_RS23680 | Protein ID | WP_043018956.1 |
| Coordinates | 4921549..4921791 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ20_RS23660 (4918678) | 4918678..4919580 | + | 903 | WP_016155183.1 | formate dehydrogenase O subunit beta | - |
| NFJ20_RS23665 (4919577) | 4919577..4920212 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFJ20_RS23670 (4920209) | 4920209..4921138 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| NFJ20_RS23675 (4921175) | 4921175..4921549 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NFJ20_RS23680 (4921549) | 4921549..4921791 | - | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
| NFJ20_RS23685 (4921997) | 4921997..4922905 | + | 909 | WP_046671350.1 | alpha/beta hydrolase | - |
| NFJ20_RS23690 (4923056) | 4923056..4923997 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| NFJ20_RS23695 (4924042) | 4924042..4924479 | - | 438 | WP_003840439.1 | D-aminoacyl-tRNA deacylase | - |
| NFJ20_RS23700 (4924476) | 4924476..4925345 | - | 870 | WP_136397728.1 | virulence factor BrkB family protein | - |
| NFJ20_RS23705 (4925339) | 4925339..4925938 | - | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T248332 WP_003028682.1 NZ_CP099298:c4921549-4921175 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1MQ96 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B5NTK4 |