Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4775117..4775783 | Replicon | chromosome |
Accession | NZ_CP099298 | ||
Organism | Citrobacter freundii strain RHB02-E3-C01 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | NFJ20_RS23010 | Protein ID | WP_086529694.1 |
Coordinates | 4775424..4775783 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | NFJ20_RS23005 | Protein ID | WP_279274146.1 |
Coordinates | 4775117..4775434 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ20_RS22970 (4770300) | 4770300..4771097 | + | 798 | WP_003841402.1 | PTS mannose/fructose/sorbose transporter subunit IIC | - |
NFJ20_RS22975 (4771109) | 4771109..4771933 | + | 825 | WP_048216971.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
NFJ20_RS22980 (4772001) | 4772001..4773224 | + | 1224 | WP_003031639.1 | L-sorbose 1-phosphate reductase | - |
NFJ20_RS22985 (4773226) | 4773226..4774038 | + | 813 | WP_200058921.1 | shikimate 5-dehydrogenase | - |
NFJ20_RS22990 (4774084) | 4774084..4774440 | - | 357 | WP_200083160.1 | hypothetical protein | - |
NFJ20_RS22995 (4774572) | 4774572..4774745 | + | 174 | WP_032938222.1 | hypothetical protein | - |
NFJ20_RS23000 (4774816) | 4774816..4774977 | + | 162 | WP_003841416.1 | phage protein | - |
NFJ20_RS23005 (4775117) | 4775117..4775434 | - | 318 | WP_279274146.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NFJ20_RS23010 (4775424) | 4775424..4775783 | - | 360 | WP_086529694.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ20_RS23015 (4775997) | 4775997..4776686 | + | 690 | WP_279274542.1 | dipeptidase PepE | - |
NFJ20_RS23020 (4776752) | 4776752..4778383 | - | 1632 | WP_003031618.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13422.52 Da Isoelectric Point: 10.2555
>T248331 WP_086529694.1 NZ_CP099298:c4775783-4775424 [Citrobacter freundii]
MTKPLYWVGQARKDLLAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
MTKPLYWVGQARKDLLAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|