Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4520016..4520636 | Replicon | chromosome |
| Accession | NZ_CP099298 | ||
| Organism | Citrobacter freundii strain RHB02-E3-C01 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NFJ20_RS21715 | Protein ID | WP_002892050.1 |
| Coordinates | 4520016..4520234 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | NFJ20_RS21720 | Protein ID | WP_003021733.1 |
| Coordinates | 4520262..4520636 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ20_RS21680 (4515249) | 4515249..4515878 | + | 630 | WP_279274121.1 | hypothetical protein | - |
| NFJ20_RS21685 (4515943) | 4515943..4516296 | + | 354 | WP_003831033.1 | DUF1428 family protein | - |
| NFJ20_RS21690 (4516348) | 4516348..4517901 | - | 1554 | WP_003835927.1 | EAL domain-containing protein | - |
| NFJ20_RS21695 (4518090) | 4518090..4518350 | + | 261 | WP_003835926.1 | type B 50S ribosomal protein L31 | - |
| NFJ20_RS21700 (4518352) | 4518352..4518492 | + | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| NFJ20_RS21705 (4518571) | 4518571..4519041 | - | 471 | WP_003021724.1 | YlaC family protein | - |
| NFJ20_RS21710 (4519158) | 4519158..4519709 | - | 552 | WP_203398439.1 | maltose O-acetyltransferase | - |
| NFJ20_RS21715 (4520016) | 4520016..4520234 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NFJ20_RS21720 (4520262) | 4520262..4520636 | - | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| NFJ20_RS21725 (4521125) | 4521125..4524274 | - | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
| NFJ20_RS21730 (4524297) | 4524297..4525490 | - | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248330 WP_002892050.1 NZ_CP099298:c4520234-4520016 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248330 WP_003021733.1 NZ_CP099298:c4520636-4520262 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |