Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3801194..3801710 | Replicon | chromosome |
| Accession | NZ_CP099298 | ||
| Organism | Citrobacter freundii strain RHB02-E3-C01 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A133L8K5 |
| Locus tag | NFJ20_RS18400 | Protein ID | WP_003844927.1 |
| Coordinates | 3801426..3801710 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0J1MV10 |
| Locus tag | NFJ20_RS18395 | Protein ID | WP_003839576.1 |
| Coordinates | 3801194..3801436 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ20_RS18375 (3796209) | 3796209..3797342 | + | 1134 | WP_279273992.1 | amidohydrolase/deacetylase family metallohydrolase | - |
| NFJ20_RS18380 (3797326) | 3797326..3798444 | + | 1119 | WP_003025770.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NFJ20_RS18385 (3798441) | 3798441..3799181 | + | 741 | WP_003025772.1 | KDGP aldolase family protein | - |
| NFJ20_RS18390 (3799203) | 3799203..3801116 | + | 1914 | WP_003839574.1 | BglG family transcription antiterminator | - |
| NFJ20_RS18395 (3801194) | 3801194..3801436 | + | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NFJ20_RS18400 (3801426) | 3801426..3801710 | + | 285 | WP_003844927.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFJ20_RS18405 (3801714) | 3801714..3802178 | - | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NFJ20_RS18410 (3802363) | 3802363..3804501 | - | 2139 | WP_003025782.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NFJ20_RS18415 (3804879) | 3804879..3805463 | - | 585 | WP_003844920.1 | fructose PTS transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10892.76 Da Isoelectric Point: 10.0482
>T248329 WP_003844927.1 NZ_CP099298:3801426-3801710 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLLYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLLYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A133L8K5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1MV10 |