Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 3065425..3066015 | Replicon | chromosome |
Accession | NZ_CP099298 | ||
Organism | Citrobacter freundii strain RHB02-E3-C01 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NFJ20_RS14830 | Protein ID | WP_181825620.1 |
Coordinates | 3065425..3065757 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A0J1NBD4 |
Locus tag | NFJ20_RS14835 | Protein ID | WP_003836694.1 |
Coordinates | 3065758..3066015 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ20_RS14795 (3060711) | 3060711..3061376 | + | 666 | WP_279273855.1 | hypothetical protein | - |
NFJ20_RS14800 (3061334) | 3061334..3061735 | + | 402 | WP_279273856.1 | SPASM domain-containing protein | - |
NFJ20_RS14805 (3062154) | 3062154..3062510 | + | 357 | WP_279273857.1 | hypothetical protein | - |
NFJ20_RS14810 (3062648) | 3062648..3062836 | + | 189 | WP_231501072.1 | helix-turn-helix domain-containing protein | - |
NFJ20_RS14815 (3062981) | 3062981..3063931 | - | 951 | WP_003836688.1 | HTH-type transcriptional regulator Cbl | - |
NFJ20_RS14820 (3064033) | 3064033..3064950 | - | 918 | WP_003030855.1 | nitrogen assimilation transcriptional regulator NAC | - |
NFJ20_RS14830 (3065425) | 3065425..3065757 | - | 333 | WP_181825620.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NFJ20_RS14835 (3065758) | 3065758..3066015 | - | 258 | WP_003836694.1 | hypothetical protein | Antitoxin |
NFJ20_RS14840 (3066630) | 3066630..3070529 | + | 3900 | WP_279273858.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3053361..3076398 | 23037 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11791.54 Da Isoelectric Point: 7.8365
>T248328 WP_181825620.1 NZ_CP099298:c3065757-3065425 [Citrobacter freundii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARTAGFTVSLDDAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARTAGFTVSLDDAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|