Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2529019..2529658 | Replicon | chromosome |
| Accession | NZ_CP099298 | ||
| Organism | Citrobacter freundii strain RHB02-E3-C01 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A8B5QF36 |
| Locus tag | NFJ20_RS12200 | Protein ID | WP_003020221.1 |
| Coordinates | 2529019..2529195 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFJ20_RS12205 | Protein ID | WP_123924900.1 |
| Coordinates | 2529242..2529658 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ20_RS12180 (2525797) | 2525797..2526027 | - | 231 | WP_003020233.1 | DUF2554 family protein | - |
| NFJ20_RS12185 (2526217) | 2526217..2526342 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| NFJ20_RS12190 (2526342) | 2526342..2527352 | - | 1011 | WP_003020227.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFJ20_RS12195 (2527352) | 2527352..2528755 | - | 1404 | WP_003843730.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFJ20_RS12200 (2529019) | 2529019..2529195 | + | 177 | WP_003020221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFJ20_RS12205 (2529242) | 2529242..2529658 | + | 417 | WP_123924900.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFJ20_RS12210 (2529751) | 2529751..2531160 | + | 1410 | WP_044702348.1 | PLP-dependent aminotransferase family protein | - |
| NFJ20_RS12215 (2531489) | 2531489..2532634 | + | 1146 | WP_279274498.1 | ABC transporter substrate-binding protein | - |
| NFJ20_RS12220 (2532651) | 2532651..2533667 | + | 1017 | WP_058842662.1 | ABC transporter ATP-binding protein | - |
| NFJ20_RS12225 (2533668) | 2533668..2534612 | + | 945 | WP_003843727.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6769.80 Da Isoelectric Point: 11.2510
>T248327 WP_003020221.1 NZ_CP099298:2529019-2529195 [Citrobacter freundii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15126.36 Da Isoelectric Point: 4.5716
>AT248327 WP_123924900.1 NZ_CP099298:2529242-2529658 [Citrobacter freundii]
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|