Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1620695..1621221 | Replicon | chromosome |
Accession | NZ_CP099298 | ||
Organism | Citrobacter freundii strain RHB02-E3-C01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NFJ20_RS07715 | Protein ID | WP_000323025.1 |
Coordinates | 1620934..1621221 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | NFJ20_RS07710 | Protein ID | WP_000534858.1 |
Coordinates | 1620695..1620934 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ20_RS07690 (1617240) | 1617240..1617812 | + | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
NFJ20_RS07695 (1618012) | 1618012..1618935 | + | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
NFJ20_RS07700 (1619101) | 1619101..1620339 | - | 1239 | WP_279274374.1 | IS110 family transposase | - |
NFJ20_RS07705 (1620572) | 1620572..1620670 | - | 99 | Protein_1502 | protein YdfV | - |
NFJ20_RS07710 (1620695) | 1620695..1620934 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NFJ20_RS07715 (1620934) | 1620934..1621221 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NFJ20_RS07720 (1621475) | 1621475..1621882 | + | 408 | WP_021567585.1 | transposase | - |
NFJ20_RS07725 (1621879) | 1621879..1622229 | + | 351 | WP_021567584.1 | IS66 family insertion sequence element accessory protein TnpB | - |
NFJ20_RS07730 (1622260) | 1622260..1623852 | + | 1593 | WP_039264109.1 | IS66 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T248321 WP_000323025.1 NZ_CP099298:1620934-1621221 [Citrobacter freundii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|