Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 832235..832889 | Replicon | chromosome |
Accession | NZ_CP099298 | ||
Organism | Citrobacter freundii strain RHB02-E3-C01 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
Locus tag | NFJ20_RS04030 | Protein ID | WP_003026936.1 |
Coordinates | 832482..832889 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A6H3AT26 |
Locus tag | NFJ20_RS04025 | Protein ID | WP_003026938.1 |
Coordinates | 832235..832501 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ20_RS04000 (827435) | 827435..828868 | - | 1434 | WP_279274273.1 | 6-phospho-beta-glucosidase BglA | - |
NFJ20_RS04005 (828990) | 828990..829718 | - | 729 | WP_279274511.1 | MurR/RpiR family transcriptional regulator | - |
NFJ20_RS04010 (829771) | 829771..830082 | + | 312 | WP_003026949.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ20_RS04015 (830245) | 830245..830904 | + | 660 | WP_003838267.1 | hemolysin III family protein | - |
NFJ20_RS04020 (830998) | 830998..831978 | - | 981 | WP_003026944.1 | tRNA-modifying protein YgfZ | - |
NFJ20_RS04025 (832235) | 832235..832501 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
NFJ20_RS04030 (832482) | 832482..832889 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
NFJ20_RS04035 (832934) | 832934..833455 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
NFJ20_RS04040 (833570) | 833570..834466 | + | 897 | WP_279274274.1 | site-specific tyrosine recombinase XerD | - |
NFJ20_RS04045 (834490) | 834490..835203 | + | 714 | WP_279274275.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ20_RS04050 (835209) | 835209..836942 | + | 1734 | WP_016150943.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T248320 WP_003026936.1 NZ_CP099298:832482-832889 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NHY7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AT26 |