Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4687551..4688217 | Replicon | chromosome |
Accession | NZ_CP099291 | ||
Organism | Citrobacter freundii strain RHB03-E1-C03 |
Toxin (Protein)
Gene name | tad | Uniprot ID | A0A0D7LIM5 |
Locus tag | NFJ31_RS22615 | Protein ID | WP_044702260.1 |
Coordinates | 4687858..4688217 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | A0A0D7LIR0 |
Locus tag | NFJ31_RS22610 | Protein ID | WP_003844682.1 |
Coordinates | 4687551..4687868 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ31_RS22580 (4683218) | 4683218..4684042 | + | 825 | WP_003031641.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
NFJ31_RS22585 (4684111) | 4684111..4685334 | + | 1224 | WP_044702265.1 | L-sorbose 1-phosphate reductase | - |
NFJ31_RS22590 (4685336) | 4685336..4686148 | + | 813 | WP_044702264.1 | shikimate 5-dehydrogenase | - |
NFJ31_RS22595 (4686200) | 4686200..4686556 | - | 357 | WP_032948294.1 | hypothetical protein | - |
NFJ31_RS22600 (4686698) | 4686698..4686859 | + | 162 | WP_003841416.1 | phage protein | - |
NFJ31_RS22605 (4687263) | 4687263..4687541 | + | 279 | WP_044702262.1 | putative addiction module antidote protein | - |
NFJ31_RS22610 (4687551) | 4687551..4687868 | - | 318 | WP_003844682.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NFJ31_RS22615 (4687858) | 4687858..4688217 | - | 360 | WP_044702260.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ31_RS22620 (4688431) | 4688431..4689120 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
NFJ31_RS22625 (4689186) | 4689186..4690817 | - | 1632 | WP_032938230.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13437.49 Da Isoelectric Point: 10.2555
>T248314 WP_044702260.1 NZ_CP099291:c4688217-4687858 [Citrobacter freundii]
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LIM5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LIR0 |